ESTScan Details for Unigene SGN-U200141

Score 
178
Direction 
Forward
Predicted Peptide Sequence 
LKPSIDTNNKVQTTPSIVHHFTSPFELKQAIAFLIKTNIPLSLLPLPRIASVCALTPYFPFAQQIFDSVNEQELSVWNSCLRKFAETPCS
AADXYVPVSANAEFNVGVDCFTCSFVLKACVELRDVSCARIVHALIEKLGYQSNLVLVNALIHLYAICGVMGDAVLLFDKMPQRDVVSW
Predicted Coding Sequence 
CTCAAACCCTCCATTGATACCAACAACAAAGTACAAACAACACCCTCCATTGTCCACCATTTCACTTCTCCATTCGAACTCAAACAAGCC
ATTGCCTTCCTCATCAAAACCAACATACCTCTCTCCCTCCTCCCACTTCCTCGTATCGCTTCTGTTTGTGCACTCACTCCATACTTTCCT
TTCGCACAGCAGATCTTCGACTCGGTTAACGAACAAGAACTTTCTGTATGGAATAGTTGTTTGAGAAAATTTGCTGAAACCCCATGTTCT
GCAGCTGATGXTTATGTTCCTGTTTCAGCAAATGCGGAGTTTAACGTGGGTGTTGATTGTTTCACTTGTTCGTTTGTTCTTAAAGCTTGT
GTGGAGTTACGGGATGTTTCGTGTGCAAGAATTGTTCACGCATTGATAGAGAAACTTGGGTATCAATCGAATTTAGTTTTGGTGAATGCG
CTGATCCATTTGTATGCGATTTGTGGAGTAATGGGTGATGCCGTCCTTCTGTTTGATAAAATGCCTCAACGAGACGTTGTGTCGTGG\
Edits in Original Sequence 
TTTCTATGTGAACTATCGTCACAATTCAGATGTATTTTTAACCATTATCTCCAAAAAGAACACGAACTATATATAGGTAATAGGTTGATC
CTTTATTAGCAACTAACATTGAAGTTTGAACCTAACACAATGCTAAATTCACTTTCCTTAGCATCTCCACTTCACCATTTGCCCTCCAAA
AAA
(5')CTCAAACCCTCCATTGATACCAACAACAAAGTACAAACAACACCCTCCATTGTCCACCATTTCACTTCTCCATTCGAACTCAA
ACAAGCCATTGCCTTCCTCATCAAAACCAACATACCTCTCTCCCTCCTCCCACTTCCTCGTATCGCTTCTGTTTGTGCACTCACTCCATA
CTTTCCTTTCGCACAGCAGATCTTCGACTCGGTTAACGAACAAGAACTTTCTGTATGGAATAGTTGTTTGAGAAAATTTGCTGAAACCCC
ATGTTCTGCAGCTGATGXTTATGTTCCTGTTTCAGCAAATGCGGAGTTaTAACGTGGGTGTTGATTGTTTCACTTGTTCGTTTGTTCTTA
AAGCTTGTGTGGAGTTACGGGATGTTTCGTGTGCAAGAATTGTTCACGCATTGATAGAGAAACTTGGGTATCAATCGAATTTAGTTTTGG
TGAATGCGCTGATCCATTTGTATGCGATTTGTGGAGTAATGGGTGATGCCGTCCTTCTGTTTGATAAAATGCCTCAACGAGACGTTGTGT
CGTGG\(3')AATGTCATGATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan