ESTScan Details for Unigene SGN-U200211

Score 
373
Direction 
Forward
Predicted Peptide Sequence 
MEHQETCQLSVIWRGKKFSLEMNPTATLKSLGDELLNLTNVRDDTMRLIVPTNKSSRLLYPFSEEHSYLKLEAASILEGKSIRMLGVPKD
EVDDILQSAKADHRILGFDEEEKRSKQRLSNGLQSTLQLPHGPYVFCDFRTLYLPGIQLNP
Predicted Coding Sequence 
ATGGAGCACCAGGAGACATGTCAATTATCTGTTATATGGAGAGGGAAGAAGTTTAGTCTGGAGATGAATCCAACTGCTACTCTCAAATCA
CTGGGGGATGAATTGCTGAATCTCACCAATGTCAGAGATGATACAATGCGCCTCATTGTGCCTACTAATAAAAGTTCAAGACTTTTGTAT
CCATTCTCTGAAGAGCATTCCTACCTAAAATTGGAAGCAGCATCCATTCTTGAGGGGAAGTCTATTAGGATGTTGGGAGTGCCCAAAGAT
GAAGTTGATGACATTCTACAGAGTGCAAAGGCAGACCACAGGATTTTGGGTTTTGATGAAGAGGAAAAAAGATCGAAACAAAGATTATCA
AATGGGCTTCAAAGTACACTACAACTTCCACACGGGCCTTATGTCTTTTGTGATTTTCGCACACTCTACCTTCCTGGTATACAGTTGAAC
CCX\
Edits in Original Sequence 
CCCAATTTGAAAAATTAACTTTCATTTCACAGAATTTTTGCCATCAATAATTCTCATAAATCACCAATCATTATCAGAAAGATAAAAAAA
TCC
(5')ATGGAGCACCAGGAGACATGTCAATTATCTGTTATATGGAGAGGGAAGAAGTTTAGTCTGGAGATGAATCCAACTGCTACTCT
CAAATCACTGGGGGATGAATTGCTGAATCTCACCAATGTCAGAGATGATACAATGCGCCTCATTGTGCCTACTAATAAAAGTTCAAGACT
TTTGTATCCATTCTCTGAAGAGCATTCCTACCTAAAATTGGAAGCAGCATCCATTCTTGAGGGGAAGTCTATTAGGATGTTGGGAGTGCC
CAAAGATGAAGTTGATGACATTCTACAGAGTGCAAAGGCAGACCACAGGATTTTGGGTTTTGATGAAGAGGAAAAAAGATCGAAACAAAG
ATTATCAAATGGGCTTCAAAGTACACTACAACTTCCACACGGGCCTTATGTCTTTTGTGATTTTCGCACACTCTACCTTCCTGGTATACA
GTTGAACCCX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan