ESTScan Details for Unigene SGN-U200253

Score 
250
Direction 
Forward
Predicted Peptide Sequence 
LRGFIAALLLNCSLKVFCSIFYAQFSDIPAQTEVVKQQVPXNMSKKKPQVFLDVSIDGDPVERMVFELLSDVAPKTGENFRALCTGEKGV
SSKSGKPLHYKGTFFHHIVKGSVAQAGDLLRQDGNYGESHLRGKAPDESPKIKHDPQGLPIMAIAX
Predicted Coding Sequence 
XXGCTTCGTGGCTTTATCGCCGCTCTCCTCCTTAACTGCTCACTCAAAGTTTTTTGCTCTATTTTTTATGCCCAATTCTCAGATATACCT
GCXCAGACTGAGGTTGTGAAGCAACAAGTTCCAGAXAACATGAGTAAGAAGAAACCACAGGTGTTCCTTGATGTTTCTATCGATGGGGAC
CCAGTTGAAAGAATGGTTTTTGAGCTTCTCAGTGATGTTGCTCCAAAAACTGGCGAAAACTTCCGTGCTCTTTGTACAGGGGAGAAAGGA
GTCAGCTCCAAGTCAGGAAAACCATTGCATTACAAAGGAACCTTTTTCCATCACATTGTCAAGGGATCTGTGGCTCAGGCTGGTGACTTG
CTGAGACAAGATGGGAACTATGGGGAGAGCCATCTACGGGGGAAAGCTCCAGATGAGTCTCCCAAGATCAAACATGATCCCCAAGGTCTA
CCTATCATGGCAATTGCGGXX\
Edits in Original Sequence 
(5')XXGCTTCGTGGCTTTATCGCCGCTCTCCTCCTTAACTGCTCACTCAAAGTTTTTTGCTCTATTTTTTATGCCCAATTCTCAGATAT
ACCTGCXCAGACTGAGGTTGTGAAGCAACAAGTTCCAGAXAACATGAGTAAGAAGAAACCACAGGTGTTCCTTGATGTTTCTATCGATGG
GGACCCAGTTGAAAGAATGGTTTTTGAGCTTCTCAGTGATGTTGCTCCAAAAACTGGCGAAAACTTCCGTGCTCTTTGTACAGGGGAGAA
AGGAGTCAGCTCCAAGTCAGGAAAACCATTGCATTACAAAGGAACCTTTTTCCATCACATTGTCAAGGGATCTGTGGCTCAGGCTGGTGA
CTTGCTGAGACAAGATGGGAACTATGGGGAGAGCCATCTACGGGGGAAAGtCTCCAGATGAGTCTCCCAAGATCAAACATGATCCCCAAG
GTCTACCTATCtATGGCAATTGCGGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan