ESTScan Details for Unigene SGN-U200297

Score 
201
Direction 
Forward
Predicted Peptide Sequence 
TRRDEGEKRDAEQWMSHRLLPEHLRERIRRYEQYKWQETRGVDEENLILNLPKDLRRDIKRHLCXALLMRVPMFEKMDDQLLDALCDRLR
PVLYTENSFIVREGDPVDEMLFIMRGKLLTVTTNGGRTGLFNSDYLKAGDFCGEELLTWALDPX
Predicted Coding Sequence 
XXGACTAGAAGAGATGAGGGTGAAAAGAGAGATGCAGAGCAGTGGATGTCTCACCGCTTACTCCCTGAGCACCTCCGAGAGCGGATCAGG
CGCTATGAGCAATACAAGTGGCAGGAAACTAGGGGTGTTGATGAAGAGAATTTGATCCTCAACCTGCCTAAAGACCTCAGAAGAGATATA
AAGCGTCATCTTTGTNTGGCTTTGCTCATGAGGGTTCCAATGTTTGAAAAAATGGATGACCAACTCCTGGATGCACTATGTGACCGACTC
AGGCCTGTCCTTTACACAGAGAACAGCTTCATTGTGCGTGAAGGTGATCCGGTTGATGAGATGCTTTTTATAATGCGGGGAAAACTATTG
ACTGTAACCACTAATGGAGGGAGGACAGGCCTTTTTAACTCTGATTATCTAAAAGCTGGTGATTTCTGTGGAGAAGAGCTTCTTACTTGG
GCTCTGGATCCTCAX\
Edits in Original Sequence 
(5')XXGACTAGAAGAGATGAGGGTGAAAAGAcGAGATGCAGAGCAGTGGATGTCTCACCGCTTACTCCCTGAGCACCTCCGAGAGCGGA
TCAGGCGCTATGAGCAATACAAGTGGCAGGAAACTAGGGGTGTTGATGAAGAGAATTTGATCCTCAACCTGCCTAAAGACCTCAGAAGAG
ATATAAAGCGTCATCTTTGTNTGGCTTTGCTCATGAGGGTTCCAATGTTTGAAAAAATGGATGACCAACTCCTGGATGCACTATGTGACC
GACTCAGGCCTGTCCTTTACACAGAGAACAGCTTCATTGTGCGTGAAGGTGATCCGGTTGATGAGATGCTTTTTATAATGCGGGGAAAAC
TATTGACTGTAACCACTAATGGAGGGAGGACAGGCCTTTTTAACTCTGATTATCTAAAAGCTGGTGATTTCTGTGGAGAAGAGCTTCTTA
CTTGGGCTCTGGATCCTCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan