ESTScan Details for Unigene SGN-U200401

Score 
643
Direction 
Forward
Predicted Peptide Sequence 
ASAGFFTKTDMAVPRGRNGEEEGGDIFEEEFEFEDPNSVPPHLLNLFDAAENGNLDALRHALDNLTGSIDQPLEDGDTALHXNMFVWPSV
LRAAIIGEGSFIEAKDEDGALPLHDACAGGYTEIAQLLINSAPNPDCVKRMLESVDVEGDTPLHHAARGEHVNVIRLLLASGACPTKTNI
YGKSPGELAAPDTEPQRILEESCSAVPSXLGLDAXDFDMVAWLSVLYX
Predicted Coding Sequence 
XXTGCAAGTGCAGGGTTTTTCACAAAAACAGATATGGCAGTACCAAGGGGACGCAATGGCGAAGAAGAAGGAGGAGATATTTTCGAAGAG
GAATTTGAATTTGAGGATCCCAATTCTGTTCCTCCTCACCTCCTTAACCTTTTCGATGCTGCTGAGAATGGAAACCTCGATGCCCTCCGC
CATGCCCTAGATAATTTGACTGGAAGCATTGATCAACCTCTTGAAGATGGGGACACTGCTCTTCATCXTAACATGTTTGTATGGCCATCT
GTCTTGCGTGCAGCTATTATTGGAGAGGGGAGCTTCATTGAGGCGAAGGATGAAGATGGAGCACTCCCATTGCATGATGCTTGTGCTGGA
GGATACACAGAGATTGCCCAACTGCTAATCAACAGTGCCCCGAATCCTGATTGTGTGAAGAGGATGTTGGAGTCCGTTGATGTAGAAGGT
GATACGCCTCTTCATCATGCTGCCAGAGGTGAACATGTAAATGTTATTAGGTTATTGCTAGCTTCAGGGGCTTGTCCTACTAAGACCAAT
ATATATGGAAAGAGCCCCGGTGAGCTTGCTGCACCTGACACCGAACCCCAAAGAATCTTAGAAGAAAGCTGCAGTGCTGTTCCTAGTXCA
TTAGGCCTTGATGCCGAXGATTTTGATATGGTAGCTTGGCTATCAGTACTATATGXX\
Edits in Original Sequence 
(5')XXTGCAAGTGCAGGGTTTTTCACAAAAACAGATATGGCAGTACCAAGGGGACGCAATGGCGAAGAAGAAGGAGGAGATATTTTCGA
AGAGGAATTTGAATTTGAGGATCCCAATTCTGTTCCTCCTCACCTCCTTAACCTTTTCGATGCTGCTGAGAATGGAAACCTCGATGCCCT
CCGCCATGCCCTAGATAATTTGACTGGAAGCATTGATCAACCTCTTGAAGATGGGGACACTGCTCTTCATCXTAACATGTTTGTATGGCC
ATCTGTCTTGCGTGCAGCTATTATTGGAGAGGGGAGCTTCATTaGAGGCGAAGGATGAAGATGGAGCACTCCCATTGCATGATGCTTGTG
CTGGAGGATACACAGAGATTGCCCAACTGCTAATCAACAGTGCCCCGAATCCTGATTGTGTGAAGAGGATGTTGGAGTCCGTTGATGTAG
AAGGTGATACGCCTCTTCATCATGCTGCCAGAGGTGAACATGTAAATGTTATTAGGTTATTGCTAGCTTCAGGGGCTTGTCCTACTAAGA
CCAATATATATGGAAAGAGCCCCGGTGAGCTTGCTGCACCTGACACCGAACCCCAAAGAATCTTAGAAGAAAGCTGCAGTGCTGTTCCTA
GTXCATTAGGCCTTGATGCCGAXGATTTTGATATGGTAGCTTGGCTATCAGTACTATATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan