ESTScan Details for Unigene SGN-U200417

Score 
88
Direction 
Reverse
Predicted Peptide Sequence 
EAVAILPQLVLLQRTRNIDTLPGQYILLLGAYRSLYILNWVYRYFTEPALCTLDNLDFRPRAELLYADFFYYYFQSWKNNTKLELPAEPX
IGDKQELAEDDPMNVYKSYVWMFNQN
Predicted Coding Sequence 
XTGGAAGCTGTCGCCATCCTTCCTCAGCTTGTCTTGTTGCAGAGAACAAGAAATATAGACACCTTGCCCGGACAATACATTTTACTCTTG
GGTGCATATCGGTCACTTTACATCTTGAACTGGGTATACCGCTACTTCACAGAACCXGCACTTTGTACATTGGATAACCTGGATTTCAGG
CCTCGTGCAGAGTTGCTTTATGCTGATTTCTTCTATTACTACTTCCAAAGCTGGAAGAACAACACGAAACTAGAACTTCCTGCTGAGCCC
ATXATCGGAGACAAACAGGAGCTGGCTGAAGATGATCCGATGAACGTTTATAAGTCTTATGTTTGGATGTTTAATCAAAACTAA\
Edits in Original Sequence 
(5')XTGGAAGCTGTCGCCATCCTTCCTCAGCTTGTCTTGTTGCAGAGAACAAGAAATATAGACACCTTGCCCGGACAATACATTTTACT
CTTGGGTGCATATCGGTCACTTTACATCTTGAACTGGGTATACCGCTACTTCACAGAACCXGCACTTTGTACATTGGATAACCTGGATTT
CAGGCCTCGTGCAGAcGTTGCTTTATGCTGATTTCTTCTATTACTACTTCCAAAGCTGGAAGAACAACACGAAACTAGAACTTCCTGCtT
GAGCCCATXATCGGAGACAAACAGGAGCTGGCTGAAGATGATCCGATGAACGTTTATAAGTCTTATGTTTGGATGTTTAATCAAAACTAA
\(3')AAACATCCTTGTTTTGTTGGCTATCATTAGGTCCAAGAGTAACAAAACCTGATATATATTCATCATATTTAGAATCTCAAGAATC
ATGTCTTTGCTATTAGTAGATGGTTAAAAGCATATATTCTTTATGTAACAGAAGTTTGTGACTTCATTTTTGTTGTACTAGAGATTGTTT
TCTTGGGACTTTTTTGTCAGTTCTTTATCAGTTCAAGAAACAGAAAATTGTCACAAAAAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan