Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U200497

Score 
244
Direction 
Forward
Predicted Peptide Sequence 
RSASDTLIPVTLELGGKXAFIVCEDVDVPQVAQVAARGALQSSGQNCAGAERFYVHKDVYSSFVAEVVKIGNRATAGPPLSGKYDX
Predicted Coding Sequence 
XXGCGGAGTGCTTCAGATACACTGATACCAGTTACCCTTGAGCTTGGTGGAAAAGANGCATTTATTGTCTGTGAAGATGTTGATGTGCCA
CAGGTTGCACAAGTCGCTGCTAGAGGAGCTCTCCAATCAAGCGGGCAGAATTGTGCTGGTGCAGAACGCTTTTATGTTCACAAGGACGTC
TACTCTTCTTTTGTTGCTGAAGTTGTTAAAATCGGAAATCGCGCTACTGCTGGACCTCCTCTGTCCGGGAAGTATGACAXX\
Edits in Original Sequence 
(5')XXGCGGAGTGCTTCAGATACACTGATACCAGTTACCCTTGAGCTTGGTGGAAAAGANGCATTTATTGTCTGTGAAGATGTTGATGT
GCCACAGGTTGCACAAGTCGCTGCTAGAGGAGCTCTCCAATCAAGCGGGCAGAATTGTGCTGGTGCAGAACGCTTTTATGTTCACAAGGA
CGTCTACTCTTCTTTTGTTGCTGAAGTTGTTAAAATCGtGAAATCGCGCTACTGCTGGACCTCCTCTGTCCGGGAAGTATGACAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan