ESTScan Details for Unigene SGN-U200529

Score 
276
Direction 
Forward
Predicted Peptide Sequence 
AIAKISTADCSKHVLIAEGLGILNNLLRVLESGSVWGKENSCIALQALVHTKENARAIGSRGGISSLLEICQTGTPNSQAMAAAVLKNLA
VFSEIKENFLEENGITILLRLSNSGTALAQENAIW
Predicted Coding Sequence 
GCCATTGCTAAAATCTCGACAGCTGATTGTAGCAAGCATGTATTGATCGCTGAAGGTTTGGGTATTCTAAACAATCTACTGAGAGTTCTC
GAATCTGGGAGTGTTTGGGGGAAGGAGAATTCGTGTATAGCTTTGCAGGCATTGGTACATACGAAGGAGAATGCAAGAGCAATTGGTTCA
AGAGGAGGAATTTCATCTTTGTTAGAGATTTGCCAAACGGGAACACCTAATTCTCAAGCTATGGCAGCTGCAGTGCTGAAAAATTTAGCA
GTTTTCTCGGAAATTAAAGAGAATTTCCTCGAAGAAAATGGGATTACGATCCTTTTAAGGTTGTCCAATTCAGGGACAGCATTAGCACAG
GAAAATGCGATCTGG\
Edits in Original Sequence 
(5')GCCATTGCTAAAATCTCGACAGCTGATTGTAGCAAGCATGTATTGATCGCTGAAGGTTTGGGTATTCTAAACAATCTACTGAGAGT
TCTCGAATCTGGGAGTGTTTGGGGGAAGGAGAATTCGTGTATAGCTTTGCAGGCATTGGTACATACGAAGGAGAATGCAAGAGCAATTGG
TTCAAGAGGAGGAATTTCATCTTTGTTAGAGATTTGCCAAACGGGAACACCTAATTCTCAAGCTATGGCAGCTGCAGTGCTGAAAAATTT
AGCAGTTTTCTCGGAAATTAAAGAGAATTTCCTCGAAGAAAATGGGATTACGATCCTTTTAAGGTTGTCCAATTCAGGGACAGCATTAGC
ACAGGAAAATGCGATCTGG\(3')TGTATATGTAATTTGATTGGTAGAGACAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan