ESTScan Details for Unigene SGN-U200580

Score 
371
Direction 
Forward
Predicted Peptide Sequence 
AXYSSGNEAAIFYILLVIGMSLCGVHPGCITLQEILISSACSTPGLAKHAGAFWGGPDYGVLSWDNKLTGAQVLLSRLRLFLSPGYPYED
ILSTFHNQTSIVMCSFLPFFTSFNRTKGGLIQLNHGRPQPLQYVVNAAFLATLYSDYLAAADTPGWYCGPNFYSTDVLRGFAQTQIDYIL
GKNPRKMSYVVGFGNHY
Predicted Coding Sequence 
XXGGCNGAXTACAGTAGTGGAAATGAAGCTGCAATTTTCTACATTCTACTAGTTATTGGGATGAGTTTGTGTGGGGTGCATCCTGGCTGT
ATTACGCTACAGGAAATTCTTATATCTTCAGCTTGCTCAACTCCTGGTCTCGCCAAACACGCTGGTGCTTTCTGGGGAGGTCCTGATTAT
GGTGTGCTCAGCTGGGATAATAAACTTACTGGGGCACAAGTGCTTCTAAGCCGTCTGAGATTGTTTTTGAGCCCTGGATATCCTTATGAA
GATATTTTGAGTACGTTTCATAACCAGACAAGCATAGTCATGTGCTCCTTCTTGCCATTCTTCACTTCTTTCAACCGCACGAAAGGAGGA
CTGATACAGTTAAATCATGGAAGGCCTCAGCCTCTTCAGTATGTGGTCAATGCTGCCTTCCTTGCTACCTTGTATAGTGACTATCTTGCA
GCTGCTGACACCCCTGGATGGTATTGTGGACCTAATTTCTACTCCACTGATGTCCTACGTGGTTTTGCACAGACTCAGATCGACTACATC
CTTGGCAAGAACCCCAGGAAAATGAGTTATGTTGTGGGCTTTGGCAATCACTAT\
Edits in Original Sequence 
(5')XXGGCNGAXTACAGTAGTGGAAATGAAGCTGCAATTTTCTACATTCTACTAGTTATTGGGATGAGTTTGTGTGGGGTGCATCCTGG
CTGTATTACGCTACAGGAAATTCTTATATCTTCAGCTTGCTCAACTCCTGGTCTCGCCAAACACGCTGGTGCTTTCTGGGGAGGTCCTGA
TTATGGTGTGCTCAGCTGGGATAATAAACTTACTGGGGCACAAGTGCTTCTAAGCCGTCTGAGATTGTTTTTGAGCCCTGGATATCCTTA
TGAAGATATTTTGAGTACGTTTCATAACCAGACAAGCATAGTCATGTGCTCCTTCTTGCCATTCTTCACTTCTTTCAACCGCACGAAAGG
AGGACTGATACAGTTAAATCATGGAAGGCCTCAGCCTCTTCAGTATGTGGTCAATGCTGCCTTCCTTGCTACCTTGTATAGTGACTATCT
TGCAGCTGCTGACACCCCTGGATGGTATTGTGGACCTAATTTCTACTCCACTGATGTCCTACGTGGTTTTGCACAGACTCAGATCGACTA
CATCCTTGGCAAGAACCCCAGGAAAATGAGTTATGTTGTGGGCTTTGGCAATCACTAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan