Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U200646

Score 
193
Direction 
Forward
Predicted Peptide Sequence 
MVDDGLRVDQKMMVVVISVCAKLEDLRLGQKLHEYVWSYKLNFDMFLGNALMDMYLKCGEPDVSLSQVX
Predicted Coding Sequence 
ATGGTAGATGATGGGTTAAGGGTTGACCAAAAGATGATGGTGGTTGTGATATCCGTTTGTGCGAAATTAGAGGATTTGAGATTAGGCCAG
AAGTTGCATGAATATGTGTGGAGTTATAAGTTGAACTTTGATATGTTTCTTGGGAATGCATTGATGGATATGTACTTAAAATGTGGTGAA
CCTGATGTTTCTCTTAGCCAAGTGTXX\
Edits in Original Sequence 
GTTAAATTTCACTCTGCATCTCTTTTCATTATTATATTGTACTTTTGACCTTTTCTTCTTTATCAGTGGAATAATTTAAGTAATCAATTT
ATGAGAGAAAAAAGAAAAGGGATTTGTAAAAATTAGTTTTAGTTTAATCTTTTTTTATTACACATTGAGGGTTATCAACAATTGTTGATA
ATAGATTTGTTCTTTGAA
(5')ATGGTAGATGATGGGTTAAGGGTTGACCAAAAGATGATGGTGGTTGTGATATCCGTTTGTGCGAAATT
AGAGGATTTGAGATTAGGCCAGAAGTTGCATGAATATGTGTGGAGTTATAAGTTGAACTTTGATATGTTTCTTGGGAATGCATTGATGGA
TATGTACTTAAAATGTGGTGAACCTGATGTTTCTCTTAGCCAAGTGTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan