ESTScan Details for Unigene SGN-U200749

Score 
189
Direction 
Forward
Predicted Peptide Sequence 
LSAATTPPPHRPLTIKAIDAAQPYDYESLVSNQYTQSGRLKIAIVGFGNFGXVLAKAFVRQDHIVFAHSRTDIQILLIH
Predicted Coding Sequence 
XCACTATCCGCCGCCACCACCCCACCACCCCATCGCCCCCTTACTATCAAAGCCATTGATGCAGCACAACCATATGACTATGAATCATTA
GTATCAAATCAATATACTCAATCGGGTAGACTCAAAATAGCCATAGTTGGTTTTGGTAACTTTGGTXCAGTTCTTGCTAAAGCTTTTGTT
AGACAAGATCATATTGTATTTGCTCATTCAAGAACTGATATTCAAATATTGCTAATTCATTAG\
Edits in Original Sequence 
(5')XCACTATCCGCCGCCACCACCCCACCACCCCtATCGCCCCCTTACTATCAAAGCCATTGATGCAGCACAACCATATGACTATGAAT
CATTAGTATCAAATCAATATACTCAATCGGGTAGACTCAAAATAGCCATAGTTGGTTTTGGTAACTTTGGTXCAGTTCTTGCTAAAGCTT
TTGTTAGACAAGATCATATTGTATTTGCTCATTCAAGAACTGATATTCAAATATTGCTAATTCATTAG\(3')GTGTTTCTTTTTTCCAA
GATCCACATGATGTATGTGAACAACACCCTGATGTTATTGTACCTTTGTACTTCAATTATATCCACCGAACCTGTACTTAAATCACTGCC
TATTCAGAGGCTGAAAAGGAATACCTTGTTTGTTGATGTTTTGTCTGTTAAAGAATTTCCTTAGAATATTTTTCTTCAAGTTTTACCTAC
CCATTCTGATATACTGTGTACTCATCCTATGTTTGGATCTGAACGTGGGAAGGATAGTCGGAAAGATCTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan