ESTScan Details for Unigene SGN-U200764

Score 
271
Direction 
Forward
Predicted Peptide Sequence 
ENALXPPGFKGDGVKSCEDIDECKQKKACQCPDAAAKIRGAVMNAVAVGTYCXIRDHDTCISKRAKEVKSAWAAVWAILIGLAMAAGGAY
LVYKYRWRSYMDSDIRAIMAQYMPLDSQX
Predicted Coding Sequence 
XXGGAAAATGCTCTTGXTCCTCCAGGGTTTAAAGGCGATGGTGTTAAAAGTTGTGAAGATATTGATGAATGTAAACAAAAGAAGGCATGT
CAATGTCCTGATGCAGCTGCAAAAATACGTGGGGCAGTTATGAATGCAGTTGCAGTGGGGACCTACTGTXACATCAGAGACCATGATACC
TGCATAAGCAAGAGAGCTAAAGAAGTCAAATCGGCATGGGCTGCTGTTTGGGCTATTTTGATTGGATTGGCTATGGCTGCTGGTGGTGCA
TATCTTGTCTACAAATACAGATGGAGGTCGTACATGGATTCAGACATCAGGGCTATTATGGCACAATATATGCCGCTGGACAGCCAAAAX
\
Edits in Original Sequence 
(5')XXGGAAAATGCTCTTGXTCCTCCAGGGTTTAAAGGCGATGGTGTTAAAAGTTGTGAAGATATTGATGAATGTAAACAAAAGAAGGC
ATGTCAATGTCCTGaATGCAGCTGCAAAAATACGTGGGGCAGTTATGAATGCAGTTGCAGTGGGGACCTACTGTXACATCAGAGACCATG
ATACCTGCATAAGCAAGAGAGCTAAAGAAGTCAAATCGGCATGGGCTGCTGTTTGGGCTATTTTGATTGGATTGGCTATGGCTGCTGGTG
GTGCATATCTTGTCTACAAATACAGATGGAGGTCGTACATGGATTCAGACATCAGGGCTATTATGGCACAATATATGCCGCTGGACAGCC
AAAAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan