ESTScan Details for Unigene SGN-U200939

Score 
456
Direction 
Forward
Predicted Peptide Sequence 
MGKLVSFFLLALIAIPMVAATVLAADAQYHIARSRYGPGSLKPSQCLPQCTRRCSKTQYHKPCMFFCQKCCKTCLCVPPGFYGNKGVCPC
YNNWKTKEGGPKCPXKQNLSTNINATLIGHPXLKLTMLFVGLLVPITAAISVLSESCL
Predicted Coding Sequence 
ATGGGGAAACTAGTTTCATTTTTCCTTTTGGCCCTCATTGCCATTCCCATGGTTGCAGCCACTGTTCTTGCTGCTGATGCCCAGTACCAC
ATTGCTCGTTCAAGGTATGGTCCAGGGAGCTTGAAGCCATCACAATGCCTGCCACAATGTACGAGGAGATGTAGCAAGACACAGTACCAC
AAGCCATGCATGTTCTTCTGTCAGAAATGCTGCAAGACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCTTGC
TACAACAACTGGAAGACCAAGGAAGGAGGACCCAAGTGCCCTXTGAAACAAAATCTCAGTACCAACATTAATGCTACTCTAATAGGTCAC
CCTAAXCTTAAATTGACTATGTTGTTTGTTGGTCTTCTTGTTCCCATTACTGCTGCTATATCCGTATTGTCTGAATCATGCCTX\
Edits in Original Sequence 
ACACTTCACAAAAAAAAAAAAAAAAAACTCTCTTTGTACTCTGTTCTTTTGCTTTCTGCTTAAGCAAAAATCAGCA(5')ATGGGGAAAC
TAGTTTCATTTTTCCTTTTGGCCCTCATTGCCATTCCCATGGTTGCAGCCACTGTTCTTGCTGCTGATGCCCAGTACCACATTGCTCGTT
CAAGGTATGGTCCAGGGAGCTTGAAGCCATCACAATGCCTGCCACAATGTACGAGGAGATGTAGCAAGACACAGTACCACAAGCCATGCA
TGTTCTTCTGTCAGAAATGCTGCAAGACATGCCTATGTGTTCCTCCTGGTTTCTATGGAAACAAAGGTGTTTGCCCTTGCTACAACAACT
GGAAGACCAAGGAAGGAGGACCCAAGTGCCCTXTGAAACAAAATCTCAGTACCAACATTAATGCTACTCTAATAGGTCACCCTAAXCTTA
AATTGACTATGTTGTTTGTTGGTCTTCTTGTTCCCATTACTGCTGCTATATCCGTATTGTCTGAATCATGCCTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan