ESTScan Details for Unigene SGN-U200995

Score 
130
Direction 
Reverse
Predicted Peptide Sequence 
EDRLLDPDIYPKLFGFTCMIFAQGGPEQRGSQEKSVSMIFASSKFFTNFEVDILVRGMGDFLNEMAAMMSQNKSNENQGETFEELQDMFD
EMFHSDVGTFSSSRTGTPSMCSTSTSSSTSPSDTFFAFSNKRSSADMNSDSSVKGDSCQFP
Predicted Coding Sequence 
GAGGATAGATTATTAGATCCTGATATTTATCCCAAATTATTCGGTTTCACTTGTATGATATTTGCTCAAGGTGGCCCGGAGCAGCGCGGT
TCTCAAGAAAAATCTGTAAGTATGATATTTGCATCAAGCAAATTTTTCACAAATTTTGAAGTGGATATTCTTGTGCGGGGCATGGGTGAC
TTCCTAAATGAAATGGCAGCTATGATGAGCCAAAATAAGTCCAATGAGAATCAGGGAGAAACCTTTGAGGAATTGCAGGATATGTTTGAC
GAAATGTTCCATAGTGATGTGGGGACGTTTTCTTCCTCTCGGACTGGGACTCCTTCGATGTGTTCTACTTCTACTTCGTCGTCTACATCT
CCCAGCGACACCTTTTTTGCCTTCTCCAACAAAAGAAGTTCAGCGGATATGAACTCGGATAGTAGCGTAAAAGGCGATTCTTGTCAATTC
CCA\
Edits in Original Sequence 
(5')GAGGATAGATTATTAGATCCTGATATTTATCCCAAATTATTCGGTTTCACTTGTATGATATTTGCTCAAGGTGGCCCGGAGCAGCG
CGGTTCTCAAGAAAAATCTGTAAGTATGATATTTGCATCAAGCAAATTgTTTCACAAATTTTGAAGTGGATATTCTTGTGCGGGGCATGG
GTGACTTCCTAAATGAAATGGCAGCTATGATGAGCCAAAATAAGTCCAATGAGAATCAGGGAGAAACCTTTGAGGAATTGCAGGATATGT
TTGACGAAATGTTCCATAGTGATGTGGGGACGTTTTCTTCCTCTCGGACTGGGACTCCTTCGATGTGTTCTACTTCTACTTCGTCGTCTA
CATCTCCCAGCGACACCTTTTTTGCCTTCTCCAACAAAAGAAGTTCAGCGGATATGAACTCGGATAGTAGCGTAAAAGGCGATTCTTGTC
AATTCCCA\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan