ESTScan Details for Unigene SGN-U200998

Score 
421
Direction 
Forward
Predicted Peptide Sequence 
RRVIDVAKDISKLFDKDPDASIQFVENRPFNDQRYFLDDQKLKSLGWSERTTWEEGLKKTMQWYINNPNWWGDVSGALLPHPRMLMMPGG
IERNMDRAEKDDSVASEISGKSNHTGMVVPASKISXSPSKSPYKFLIYGSDWVDWWSARQPA
Predicted Coding Sequence 
XXGAGGCGAGTGATTGATGTTGCCAAAGATATATCCAAGCTTTTTGACAAGGATCCAGATGCAAGCATTCAGTTTGTGGAGAATAGGCCC
TTCAATGACCAGAGGTATTTCCTAGATGATCAGAAGTTGAAGAGCTTGGGTTGGTCCGAGAGGACCACGTGGGAAGAGGGTCTGAAAAAA
ACCATGCAGTGGTATATCAATAATCCTAATTGGTGGGGAGATGTCTCTGGAGCATTGCTTCCCCATCCAAGAATGCTGATGATGCCTGGT
GGGATAGAGAGAAATATGGATAGAGCTGAAAAAGATGATTCTGTAGCATCTGAAATCTCAGGAAAATCCAATCATACCGGAATGGTAGTC
CCAGCTTCCAAGATCAGCAANTCCCCTAGTAAATCACCTTATAAGTTTCTGATTTATGGTAGCGACTGGGTGGATTGGTGGTCTGCTAGG
CAACCTGCGTGA\
Edits in Original Sequence 
(5')XXGAGGCGAGTGATTGATGTTGCCAAAGATATATCCAAGCTTTTTGACAAGGATCCAGATGCAAGCATTCAGTTTGTGGAGAATAG
GCCCTTCAATGACCAGAGGTATTTCCTAGATGATCAGAAGTTGAAGAGCTTGGGTTGGTCCGAGAGGACCACGTGGGAAGAGGGTCTGAA
AAAAACCATGCAGTGGTATATCAATAATCCTAATTGGTGGGGAGATGTCTCTGGAGCATTGCTTCCCCATCCAAGAATGCTGATGATGCC
TGGTGGGATAGAGAGAAATATGGATAGAGCTGAAAAAGATGATTCTGTAGCATCTGAAATCTCAGGAAAATCCAATCATACCGGAATGGT
AGTCCCAGCTTCCAAGATCAGCAANTCCCCTAGTAAATCACCTTATAAGTTTCTGATTTATGGTAGCGACTGGGTGGATTGGTGGTCTGC
TAGGCAACCTGCGTGA\(3')GAAACAGGGAATATCTTAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan