Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U201139

Score 
118
Direction 
Forward
Predicted Peptide Sequence 
KIGVRFDKPXPDGVNFGGLCDDGHGFFCKVSELRLEASGADDLDKLLITTLFEVVFTESRNCPLILFMKDAEKSMAGSSQSYSTFKNRLE
KLTANX
Predicted Coding Sequence 
XXAAAAATTGGTGTAAGGTTTGATAAGCCAXTACCAGACGGGGTTAACTTTGGGGGTCTTTGTGATGATGGTCATGGATTCTTTTGCAAG
GTCAGTGAGCTACGCTTGGAAGCCTCTGGTGCCGATGATCTTGACAAGTTACTCATTACCACATTGTTTGAGGTTGTATTCACCGAGAGC
AGAAATTGCCCCTTGATTTTATTTATGAAAGATGCTGAGAAATCTATGGCGGGGAGTTCACAATCGTATTCCACTTTTAAAAATCGGCTT
GAAAAGCTTACTGCTAACAXX\
Edits in Original Sequence 
(5')XXAAAAATTGGTGTAAGGTTTGATAAGCCAXTACCAGACGGGGTTAACTTTGGGGGTCTTTGTGATGATGGTCATGGATTCTTTTG
CAAGGTCAGTGAGCTACGCTTGGAAGCCTCTGGTGCCGATGATCTTGACAAGTTACTCATTACCACATTGTTTGAGGTTGTATTCACCGA
GAGCAGAAATTGCCCCTTGATTTTATTTATGAAAGATGCTGAGAAATCTATGGCGGGGAGTTCACAATCGTATTCCACTTTTAAAAATCG
GCTTGAAAAGCTTACTGCTAACAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan