ESTScan Details for Unigene SGN-U201260

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
LKPNIQLRVMEKDSSFLFGGISFNRKKFARDFDRFKGKTPVDSSEKLQFIEKEHRTIDSSLENLEIPENEKSEMEDERNTSVVKKRKRKE
KGTGSGIGFRLRGRIFRVQEFKIKRKLQRKKKSEMN
Predicted Coding Sequence 
CTGAAACCAAATATCCAGTTGAGAGTTATGGAAAAAGATTCATCTTTCTTGTTTGGTGGCATCTCTTTCAACCGTAAAAAGTTTGCTCGC
GATTTCGACAGATTTAAGGGGAAAACCCCAGTTGATTCGTCTGAGAAACTGCAGTTCATTGAGAAGGAGCACAGAACTATTGATAGTTCA
TTAGAGAACCTGGAGATCCCCGAGAATGAAAAGTCTGAAATGGAGGACGAGAGAAATACCAGCGTGGTTAAGAAGAGAAAGAGGAAGGAG
AAGGGAACAGGTTCTGGCATTGGCTTTAGACTCCGTGGAAGGATTTTCCGTGTTCAAGAGTTCAAAATTAAAAGGAAGCTGCAGCGAAAG
AAGAAATCTGAAATGAAC\
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTCGTTGAACTTGAGTTTCTATTTTATTTATCAAAATACATTGTGAAATAAGCAGTAGGTAACATAAACAATG
CAACTTTTGCCAGAATAGACAGAATTAAAAGAAAAGATAAAAATAAACGAATGAGTACACAAATATTCATCTAATTTTTGCTAA
(5')CT
GAAACCAAATATCCAGTTGAGAGTTATGGAAAAAGATTCATCTTTCTTGTTTGGTGGCATCTCTTTCAACCGTAAAAAGTTTGCTCGCGA
TTTCGACAGATTTAAGGGGAAAACCCCAGTTGATTCGTCTGAGAAACTGCAGTTCATTGAGAAGGAGCACAGAACTATTGATAGTTCATT
AGAGAACCTGGAGATCCCCGAGAATGAAAAGTCTGAAATGGAGGACGAGAGAAATACCAGCGTGGTTAAGAAGAGAAAGAGGAAGGAGAA
GGGAACAGGTTCTGGCATTGGCTTTAGACTCCGTGGAAGGATTTTCCGTGTTCAAGAGTTCAAAATTAAAAGGAAGCTGCAGCGAAAGAA
GAtAATCTGAAATGAAC\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan