ESTScan Details for Unigene SGN-U201309

Score 
427
Direction 
Forward
Predicted Peptide Sequence 
VSSEQQHPSPSVVPPVRRSSKSYFIPSYLSDYVCNSISKVSSIKAPILEPQVYHQDIFHPAWQDAMLQEFHALEASNTWDIVPLPPHKKP
ISSKCVYKIKHKSDGSVERYKARQLFEXDTQQEGIDYTKTFSHVVKFSTIKVLLFIVVKKNWTVYQLDDNNSFLHGDLHEEVYMKPPLGM
ASPSSVPTX
Predicted Coding Sequence 
GTTTCTTCTGAACAACAACACCCTTCTCCTTCTGTTGTTCCCCCTGTTAGAAGGTCCTCCAAATCCTACTTTATCCCTTCTTACTTATCA
GATTATGTCTGCAATTCAATATCCAAGGTTTCCTCTATTAAGGCTCCTATACTTGAACCTCAGGTCTATCATCAGGATATTTTTCATCCT
GCCTGGCAGGATGCCATGCTTCAAGAATTTCATGCTCTTGAAGCAAGTAACACTTGGGATATAGTTCCCTTGCCTCCTCACAAGAAACCC
ATTTCAAGTAAGTGTGTCTACAAAATTAAACACAAGTCTGATGGCTCTGTGGAAAGATACAAAGCTAGACAGTTATTTGAGGXTGATACT
CAACAGGAGGGCATTGACTACACTAAGACTTTCTCTCATGTGGTTAAATTCTCCACCATTAAAGTCCTTCTCTTTATTGTTGTCAAGAAA
AATTGGACTGTTTATCAACTTGATGACAATAATTCTTTCCTTCATGGTGATCTCCATGAAGAGGTGTACATGAAGCCTCCTCTTGGCATG
GCATCTCCTTCTTCTGTGCCTACTTXX\
Edits in Original Sequence 
(5')GTTTCTTCTGAACAACAACACCCTTCTCCTTCTGTTGTTCCCCCTGTTAGAAGGTCCTCCAAATCCTACTTTATCCCTTCTTACTT
ATCAGATTATGTCTGCAATTCAATATCCAAGGTTTCCTCTATTAAGGCTCCTATACTTGAACCTCAGGTCTATCATCAGGATATTTTTCA
TCCTGCCTGGCAGGATGCCATGCTTCAAGAATTTCATGCTCTTGAAGCAAGTAACACTTGGGATATAGTTCCCTTGCCTCCTCACAAGAA
ACCCATTTCAAGTAAGTGTGTCTACAAAATTAAACACAAGTCTGATGGCTCTGTGGAAAGATACAAAGCTAGACtAGTTATTTGAGGXTG
ATACTCAACAGGAGGGCATTGACTACACTAAGACTTTCTCTCATGTGGTTAAATTCTCCACCATTAAAGTCCTTCTCTTTATTGTTGTCA
AGAAAAATTGGACTGTTTATCAACTTGATGACAATAATTCTTTCCTTCATGGTGATCTCCATGAAGAGGTGTACATGAAGCCTCCTCTTG
GCATGGCATCTCCTTCTTCTGTGCCTACTTXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan