Notice: After server upgrades, BLAST should be back now. Apologies for any inconvenience.

ESTScan Details for Unigene SGN-U201316

Score 
456
Direction 
Forward
Predicted Peptide Sequence 
MGAEKNGNDRKGSENVEMKNKRKRRKVVVSRVQKLYKTCKLVFANCRPGVVPSMENVERVKAVLDKMTLADVGLRRNMPYFKSTVSSDRP
PKITYLHLHECDKFSMGIFCLPPKAVIPLHNHPGMTVLSKLLFGKMHIKSYDWADNLLPESTPNANNFDRYGNTGTRLAKLKVNPKX
Predicted Coding Sequence 
ATGGGGGCTGAGAAAAATGGAAATGATCGAAAAGGTAGTGAAAATGTAGAGATGAAGAATAAGCGCAAACGGAGAAAAGTAGTAGTTTCA
AGGGTTCAGAAACTGTATAAAACTTGCAAACTGGTTTTTGCTAATTGCAGACCTGGCGTTGTGCCGTCAATGGAAAATGTTGAACGTGTC
AAGGCAGTTTTAGATAAGATGACTTTAGCTGATGTTGGTTTGAGACGAAATATGCCATATTTCAAGTCAACGGTATCATCAGATAGACCT
CCTAAAATAACATACCTGCATCTCCATGAATGTGACAAATTCTCGATGGGTATCTTTTGCTTACCACCAAAAGCAGTCATTCCTCTTCAT
AACCATCCTGGAATGACAGTTCTCAGCAAGCTTCTCTTTGGGAAAATGCACATAAAATCTTACGACTGGGCAGACAATCTCCTTCCTGAA
TCAACTCCAAATGCCAATAATTTTGACAGGTATGGTAATACAGGAACACGTCTTGCAAAATTGAAGGTGAATCCCAAGTTX\
Edits in Original Sequence 
AATATATTAGTACAACAGTAAAATTTCGTTGCTATTTTTTCGTATTTTCTTGAATTAATCAATATTTGGATTAA(5')ATGGGGGCTGAG
AAAAATGGAAATGATCGAAAAGGTAGTGAAAATGTAGAGATGAAGAATAAGCGCAAACGGAGAAAAGTAGTAGTTTCAAGGGTTCAGAAA
CTGTATAAAACTTGCAAACTGGTTTTTGCTAATTGCAGACCTGGCGTTGTGCCGTCAATGGAAAATGTTGAACGTGTCAAGGCAGTTTTA
GATAAGATGACTTTAGCTGATGTTGGTTTGAGACGAAATATGCCATATTTCAAGTCAACGGTATCATCAGATAGACCTCCTAAAATAACA
TACCTGCATCTCCATGAATGTGACAAATTCTCGATGGGTATCTTTTGCTTACCACCAAAAGCAGTCATTCCTCTTCATAACCATCCTGGA
ATGACAGTTCTCAGCAAGCTTCTCTTTGGGAAAATGCACATAAAATCTTACGACTGGGCAGACAATCTCCTTCCTGAATCAACTCCAAAT
GCCAATAATTTTGACAGGTATGGTAATACAGGAACACGTCTTGCAAAATTGAAGGTGAATCCCAAGTTX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan