ESTScan Details for Unigene SGN-U201436

Score 
257
Direction 
Forward
Predicted Peptide Sequence 
KTASPADFKIXVGMSTGGELLQIEPVELQFPFELKKQISCSMQLTNKSDDYVAFKVKTTNPKKYCVRPNTGIVMPHSASDVTATMQAQKE
APPDMQCKDKFLLQSVVTSPGATAKDITPEMFYKX
Predicted Coding Sequence 
XGGAAAACCGCTTCTCCGGCCGATTTCAAGATCGXCGTCGGAATGAGTACCGGAGGAGAGCTTCTTCAAATCGAGCCTGTTGAGCTTCAG
TTTCCCTTTGAATTGAAGAAGCAGATCTCATGCTCCATGCAGTTGACGAACAAGTCGGATGATTATGTTGCTTTCAAGGTGAAGACAACG
AATCCAAAGAAGTATTGTGTAAGGCCCAACACTGGAATTGTCATGCCTCACTCTGCCAGCGATGTCACAGCTACAATGCAAGCGCAGAAA
GAGGCTCCACCGGACATGCAATGCAAGGATAAATTCCTGCTTCAAAGTGTTGTCACAAGCCCAGGAGCTACTGCAAAGGACATTACTCCC
GAGATGTTCTATAAGGAX\
Edits in Original Sequence 
(5')XGGAAAACCGCTTCTCCGGCCGATTTCAAGATCGXCGTCGGAATGAGTACCGGAGGAGAGCTTCTTCAAATCGAGCCTGTTGAGCT
TCAGTTTCCCTTTGAATTGAAGAAGCAGATCTCATGCTCCATGCAGTTGACGAACAAGTCGGATGATTATGTTGCTTTCAAGGTGAAGAC
AACGAATCCAAAGAAGTATTGTGTAAGGCCCAACACTGGAATTGTCATGCCTCACTCTGCCAGCGATGTCACAGCTACAATGCAAGCGCA
GAAAGAGGCTCCACCGGACATGCAATGCAAGGATAAATTCCTGCTTCAAAGTGTTGTCACAAGCCCAGGAGCTACTGCAAAGGACATTAC
TCCCGAGATGTTCTATAAGGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan