ESTScan Details for Unigene SGN-U201494

Score 
77
Direction 
Reverse
Predicted Peptide Sequence 
RFGGTXVYGVYVDVFTDHKSLQYXVLLEIPKPPSEKVVGVAKDYDISFLYYPGEANVVINALSRMSMGNVAHMDHGMKKLAQEVHQLSQL
GVRFVDSVEGSVWVQSCSESTLVSEVKEKKDRDPSLFXVKIISQRSKIDAFSQGEIVYYIVX
Predicted Coding Sequence 
AGATTTGGAGGCACTXATGTGTATGGTGTGTACGTTGATGTTTTCACTGACCATAAGAGCCTACAATATGXTGTTCTCTTAGAAATACCT
AAACCACCATCAGAGAAAGTGGTTGGAGTTGCTAAAGATTATGACATAAGTTTTCTGTATTATCCAGGTGAAGCCAATGTAGTGATTAAT
GCTCTAAGTAGGATGTCTATGGGTAATGTTGCTCACATGGATCATGGTATGAAGAAGTTAGCTCAGGAAGTTCATCAGCTTTCTCAACTA
GGTGTCCGGTTTGTCGACTCAGTAGAAGGTAGTGTATGGGTGCAGAGTTGTTCAGAATCAACTTTGGTTTCTGAGGTAAAGGAAAAGAAA
GATAGGGATCCTAGCCTATTTAXAGTTAAAATAATCAGTCAGAGATCAAAGATAGACGCTTTCTCACAAGGGGAGATAGTGTATTACATT
GTTAGX\
Edits in Original Sequence 
(5')AGATTTGGAGGCACTXATGTGTATGGTGTGTACGTTGATGTTTTCACTGACCATAAGAGCCTACAATATGXTGTTCTCTTAGAAAT
ACCTAAACCACCATCAGAGAAAGTGGTTGGAGTTGCTAtAAGATTATGACATAAGTTTTCTGTATTATCCAGGTGAAGCCAATGTAGTGA
TTAATGCTCTAAGTAGGATGTCTATGGGTAATGTTGCTCACATGGATCATGGTATGAAGAAGTTAGCTCAGGAAGTTCATCAGCTTTCTC
AACTAGGTGTCCGGTTTGTCGACTCAGTAGAAGGTAGTGTATGGGTGCAGAGTTGTTCAGAATCAACTTTGGTTTCTGAGGTAAAGGAAA
AGAAAGATAGGGATCCTAGCCTATTTAXAGTTAAAATAATCAGTCAGAGATCAtAAGATAGACGCTTTCTCACAAGGGGAGATAGTGTAT
TACATTGTTAGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan