ESTScan Details for Unigene SGN-U201532

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
MGSKPWLHPAPTYRLLETFWDTDEDAPGPRCGHTLTAVGATKTHGARLILFGGATAIEGGNGAAPGIRLAGVTNCIHSFDVLTRKWTRLR
PAGEPPSPRAAHAAAAVGTMVVFQGWDRTGGHSTDDLYVLDMTNEKFKWHRLVVQGQGSAPRYGHVMDLVAQRYLVTVSGNDGKRVLSDG
WALDT
Predicted Coding Sequence 
ATGGGTTCGAAGCCGTGGCTACATCCAGCTCCAACCTATCGTCTGCTAGAAACGTTTTGGGATACGGATGAGGATGCCCCAGGTCCACGT
TGTGGTCATACTCTCACTGCTGTAGGTGCCACCAAGACCCATGGTGCCCGGCTTATACTGTTTGGTGGTGCCACTGCTATCGAGGGTGGC
AATGGGGCTGCCCCTGGCATAAGGCTGGCTGGTGTAACCAATTGTATTCATTCGTTCGATGTTCTTACCAGAAAATGGACTAGACTTAGA
CCAGCTGGTGAACCACCTTCACCAAGAGCTGCACATGCTGCTGCGGCTGTTGGAACAATGGTTGTATTCCAGGGCTGGGATAGGACCGGT
GGGCATTCAACTGATGATCTTTATGTGCTTGACATGACAAATGAAAAGTTCAAGTGGCACAGACTTGTTGTTCAAGGTCAGGGCTCTGCA
CCACGGTATGGCCATGTAATGGACTTGGTTGCACAAAGATATCTGGTAACTGTCAGTGGCAATGACGGGAAAAGAGTTCTTTCTGATGGT
TGGGCCTTGGATACT\
Edits in Original Sequence 
TTCAATTGTTGGATCCAAATTCACTTTTATTTTCTGTAGAGTGACAGTTTTTTGCTTTTATTGCAAATAAGGTTGTTGTGGTTGATTAAT
TTTTGATG
(5')ATGGGTTCGAAGCCGTGGCTACATCCAGCTCCAACCTATCGTCTGCTAGAAACGTTTTGGGATACGGATGAGGATGCC
CCAGGTCCACGTTGTGGTCATACTCTCACTGCTGTAGGTGCCACCAAGACCCATGGTGCCCGGCTTATACTGTTTGGTGGTGCCACTGCT
ATCGAGGGTGGCAATGGGGCTGCCCCTGGCATAAGGCTGGCTGGTGTAACCAATTGTATTCATTCGTTCGATGTTCTTACCAGAAAATGG
ACTAGACTTAGACCAGCTGGTGAACCACCTTCACCAAGAGCTGCACATGCTGCTGCGGCTGTTGGAACAATGGTTGTATTCCAGGGCTGG
GATAGGACCGGcTGGGCATTCAACTGATGATCTTTATGTGCTTGACATGACAAATGAAAAGTTCAAGTGGCACAGACTTGTTGTTCAAGG
TCAGGGCTCTGCACCACGGTATGGCCATGTAATGGACTTGGTTGCACAAAGATATCTGGTAACTGTCAGTGGCAATGACGGGAAAAGAGT
TCTTTCTGATGGTTGGGCCTTGGATACT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan