ESTScan Details for Unigene SGN-U201568

Score 
233
Direction 
Reverse
Predicted Peptide Sequence 
RKVSEAFKSYPMFLGSFKNXLQVRVRSSKKAKGLLEDPTTQPDDTSGGSEQHRLYLLLTIIPVHKFSSGKPDESGAFHVYVHVGGSSDLK
NEELERTVAQLQSKLKDVTAELEAEHEKGHKEVEQLTSENAKLKYRIKHLVRSLEEALSKSTSK
Predicted Coding Sequence 
AGAAAGGTTAGTGAAGCCTTCAAATCATATCCTATGTTTCTCGGATCTTTCAAAAATGXTCTTCAGGTGCGTGTCAGGTCCTCCAAAAAG
GCAAAAGGACTTTTGGAAGATCCGACAACACAACCCGATGACACTTCTGGAGGATCCGAGCAACATAGATTATATCTCCTGTTGACAATA
ATTCCAGTTCATAAGTTCTCATCTGGTAAACCCGATGAGTCTGGTGCTTTTCATGTTTATGTGCATGTTGGTGGCTCTTCAGATCTGAAA
AACGAGGAATTAGAGAGAACAGTTGCTCAACTCCAGTCGAAGCTGAAAGATGTCACTGCTGAGCTTGAAGCAGAACATGAAAAGGGACAT
AAAGAGGTAGAACAACTTACTTCAGAGAACGCGAAGCTCAAATATCGTATCAAACATCTAGTTAGATCACTAGAGGAGGCTCTTAGCAAG
TCGACGTCAAAGTGA\
Edits in Original Sequence 
(5')AGAAAGGTTAGTGAAGCCTTCAAATCATATCCTATGTTTCTCGGATCTTTCAAAAATGXTCTTCAGGTGCGTGTCAGGTCCTCCAA
AAAGGCAAAAGtGACTTTTGGAAGATCCGACAACACAACCCGATGACACTTCTGGAGGATCCGAGCAACATAGATTATATCTCCTGTTGA
CAATAATTCCAGTTCATAAGTTCTCATCTGtGTAAACCCGATGAGTCTGGTGCgTTTTCATGTTTATGTGCATGTTGGTGGCTCTTCAGA
TCTGAAAAACGAGGAATTAGAGAGAACAGTTGCTCAACTCCAGTCGAAGCTGAAAGATGTCACTGCTGAGCTTGAAGCAGAACATGAAAA
GGGACATAAAGAGGTAGAACAACTTACTTCAGAGAACGCGAAGCTCAAATATCGTATCAAACATCTAGTTAGATCACTAGAGGAGGCTCT
TAGCAAGTCGACGTCAAAGTGA\(3')GGTTATATCTCCTAGAGTTGGTTGCATTGAACTTAAGTGTGAAAATTACTCACAAAAAAGTTT
TTTAAGTCTCATTGCTGTTGTTGTTGGTTCATCTTACTATCAAAATATTGTCAATTTGTTTGCAAAAAACAAAGTTTCAGTTGTCTGACT
CAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan