ESTScan Details for Unigene SGN-U201593

Score 
304
Direction 
Forward
Predicted Peptide Sequence 
MGKEMALEPAHTVKARHVLCEKQSKINEAYKKLQEGWLDNGDKVPPPEFSKVPAAYSQCPSGKKGGDLGWFPRGKMAGPFQEAAFTTPVA
ATSAPFKSTHGYHFILCX
Predicted Coding Sequence 
ATGGGAAAGGAGATGGCCTTGGAACCTGCACATACXGTTAAAGCAAGGCATGTGTTATGTGAGAAGCAGTCGAAGATTAATGAAGCATAT
AAAAAACTACAGGAAGGCTGGCTGGACAATGGAGATAAAGTTCCACCACCTGAGTTTTCCAAGGTACCTGCAGCTTACTCGCAATGCCCC
TCAGGAAAGAAAGGAGGAGACCTGGGATGGTTTCCACGTGGCAAGATGGCAGGCCCGTTTCAGGAAGCCGCCTTCACTACCCCTGTTGCA
GCCACCAGTGCACCCTTTAAATCAACACATGGATACCATTTCATTTTATGTGXX\
Edits in Original Sequence 
CTCCACTATATCTTGACGTGCATGATATGCTGTGACAAAGGGGTAACACAAGTTGAATAACTTCAAATTAAGAAGTT(5')ATGGGAAAG
GAGATGGCCTTGGAACCTGCACATACXGTTAAAGCAAGGCATGTGTTATGTGAGAAGCAGTCGAAGATTAATGAAGCATATAAAAAACTA
CAGGAAGGCTGGCTGGACAATGGAGATAAAGTTCCACCACCTGAGTTTTCCAAGGTACCTGCAGCTTACTCGCAATGCCCCTCAGGAAAG
AAAGGAGGAGACCTGGGATGGTTTCCACGTGGCAAGATGGCAGGCCCGTTTCAGGAAGCCGCCTTCACTACCCCTGTTGCAGCCACCAGT
GCACCCTTTAAATCAACACATGGATACCATTTCATTTTATGTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan