ESTScan Details for Unigene SGN-U201640

Score 
211
Direction 
Forward
Predicted Peptide Sequence 
LHKVHRFPSVSFVPLHRVSSAEFPAGHFSGEIDLSNLNDGSYHISEGELXRGRPMPRYKDEAPAVWVYTVCDESKYLIVRNVPALGCADQ
LSQXFSTYGQIQECKPMDAEXLRAIYRTSSGSSFAGVDNARFGKRKLDESVSLGNRLQISYAPQFESLDDXKGEVKSEAKGSLNAIKX
Predicted Coding Sequence 
XXCCTACACAAAGTTCACCGTTTCCCTTCTGTGAGCTTTGTTCCTCTCCATCGCGTTTCCTCTGCCGAATTCCCCGCCGGTCACTTCTCC
GGCGAAATCGATCTGTCGAATCTCAATGATGGGAGTTATCACATAAGCGAAGGTGAGTTGTGAAGGGGAAGGCCAATGCCTCGATACAAA
GACGAGGCTCCTGCAGTCTGGGTTTACACAGTTTGTGATGAATCCAAATATTTGATTGTGAGGAATGTTCCGGCATTGGGTTGTGCTGAT
CAGCTCTCTCAANTATTCTCCACTTATGGTCAAATCCAAGAGTGTAAACCAATGGATGCTGAAGAXTTGCGAGCCATTTACCGGACGTCT
TCTGGATCAAGTTTTGCTGGXGTTGACAATGCCAGGTTTGGCAAAAGGAAACTGGATGAGTCTGTTTCCCTAGGGAACAGGTTACAGATC
TCTTATGCACCTCAATTTGAGAGTCTGGATGACAXCAAAGGAGAAGTTAAAAGTGAGGCGAAAGGAAGTCTTAATGCGATTAAACXX\
Edits in Original Sequence 
(5')XXCCTACACAAAGTTCACCGTTTCCCTTCTGTGAGCTTTGTTCCTCTCCATCGCGTTTCCTCTGCCGAATTCCCCGCCGGTCAcCT
TCTCCGGCGAAATCGATCTGTCGAATCTCAATGATGGGAGTTATCACATAAGCGAAGGTGAGTTGTGAAGGGGAAGGCCAATGCCTCGAT
ACAAAGACGAGGCTCCTGCAGTCTGGGTTTACACAGTTTGTGATGAATCCAAATATTTGATTGTGAGGAATGTTCCGGCATTGGGTTGTG
CTGATCAGCTCTCTCAANTATTCTCCACTTATGGTCAAATCCAAGAGTGTAAACCAATGGATGCTGAAGAXTTGCGAGCCATTTACCGGA
CGTCTTCTGGATCAAGTTTTGCTGGXGTTGACAATGCCAGGTTTGGCAAAAGGAAACTGGATGAGTCTGTTTCCCTAGGGAACAGGTTAC
AGATCTCTTATGCACCTCAATTTGAGAGTCTGGATGACAXCAAAGGAGAAGTTAAAAGTGAGGCGAAAGGAAGTCTTAATGCGATTAAAC
XX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan