ESTScan Details for Unigene SGN-U201761

Score 
359
Direction 
Forward
Predicted Peptide Sequence 
MTKAALFVRPNVAGAMYPAMEHLRSATCTFIPEMLFYIFPFLPADEPPSSHRSNIEADFAGRRSFSIRATSDTGSFDSPLMQSMEKKIKE
QLNADRVVVKDAYGDGRHVSIDVISSAFGGQSAVNRQRMVYKAIWEELHNVVHAVDQMTTKTPTEAAAGKXTKAQST
Predicted Coding Sequence 
ATGACGAAGGCGGCTCTATTTGTGAGGCCAAACGTGGCGGGTGCTATGTATCCGGCGATGGAGCACCTCCGTTCAGCCACGTGTACCTTC
ATTCCTGAAATGCTATTCTATATCTTCCCCTTCCTACCGGCCGATGAACCTCCTTCCTCACATAGGTCCAACATTGAAGCCGATTTCGCC
GGTCGACGGAGTTTTAGTATTCGAGCAACTAGCGACACCGGCTCATTTGATTCCCCTCTTATGCAGTCTATGGAGAAAAAGATCAAGGAA
CAGTTGAATGCGGACAGAGTCGTAGTGAAAGATGCTTATGGTGATGGTCGGCATGTCAGCATTGATGTAATCTCTTCAGCTTTTGGGGGA
CAATCTGCTGTGAATAGGCAGAGGATGGTCTACAAAGCCATATGGGAAGAACTTCATAATGTTGTGCATGCAGTTGACCAGATGACTACC
AAAACACCAACCGAAGCAGCTGCAGGGAAGXTGACTAAGGCGCAATCTACT\
Edits in Original Sequence 
TTGCTGTAAAGAATTATCCATGGATAGAGATAACCCAGGTCTTTTGTCTTGCAAAAAAAAAAAAAAAAAACTCCAGACCGCAAGGGAAAG
AGAAATTAGAG
(5')ATGACGAAGGCGGCTCTATTTGTGAGGCCAAACGTGGCGGGTGCTATGTATCCGGCGATGGAGCACCTCCGTTCA
GCCACGTGTACCTTCATTCCTGAAATGCTATTCTATATCTTCCCCTTCCTACCGGCCGATGAACCTCCTTCCTCACATAcGGTCCAACAT
TGAAGCCGATTTCGCCGGTCGACGGAGTTTTAGTATTCGAGCAACTAGCGACACCGGCTCATTTGATTCCCCTCTTATGCAGTCTATGGA
GAAAAAGATCAAGGAACAGTTGAATGCGGACAGAGTCGTAGTGAAAGATGCTTATGGTGATGGTCGGCATGTCAGCATTGATGTAATCTC
TTCAGCTTTTGGGGGACAATCTGCTGTGAATAGGCAGAGGATGGTCTACAAAGCCATATGGGAAGAACTTCATAATGTTGTGCATGCAGT
TGACCAGATGACTACCAAAACACCAACCGAAGCAGCTGCAGGGAAGXTGACTAAGGCGCAATCTACT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan