ESTScan Details for Unigene SGN-U201917

Score 
496
Direction 
Forward
Predicted Peptide Sequence 
MVDEFMVCVDRIIIATTCFADSSNGEALSTSDDANANSRKTDEKTISNNNNSGGSGSGEGCSKGSVIRECRICQEEDDETDMEAPCACNG
TLKFAHGNVSRNGATKKVI
Predicted Coding Sequence 
ATGGTGGATGAGTTCATGGTGTGTGTAGATAGGATCATAATAGCAACAACATGTTTTGCTGATTCTTCAAATGGAGAAGCACTTTCGACT
AGTGATGATGCAAATGCCAATTCAAGAAAGACAGATGAAAAAACAATTAGCAACAACAATAATAGTGGTGGTAGTGGTAGTGGAGAGGGT
TGTTCAAAGGGTAGTGTTATTAGAGAATGTAGAATTTGTCAAGAAGAAGATGATGAAACTGACATGGAAGCTCCTTGTGCTTGCAATGGC
ACTCTCAAGTTTGCTCATGGAAATGTATCCAGAAATGGTGCAACAAAAAAGGTGATATAA\
Edits in Original Sequence 
CTACTTTCATTTTCTTTACATTGTTTTCTCCTTCCTTCCTCCTCTTCACTTGTCTGTCTCTTCTAGCCTAGAGAGAGAAAAAAAAAAAGA
AGGAAAA
(5')ATGGTGGATGAGTTCATGGTGTGTGTAGATAGGATCATAATAGCAACAACATGTTTTGCTGATTCTTCAAATGGAGAAG
CACTTTCGACTAGTGATGATGCAAATGCCAATTCAAGAAAGACAGATGAAAAAACAATTAGCAACAACAATAATAGTGGTGGTAGTGGTA
GTGGAGAGGGTTGTTCAAAGGGTAGTGTTATTAGAGAATGTAGAATTTGTCAAGAAGAAGATGATGAAACTGACATGGAAGCTCCTTGTG
CTTGCAATGGCACTCTCAAGTTTGCTCATaGGAAATGTATCCAGAAATGGTGCAACAAAAAAGGTGATATAA\(3')CCTGTGAAATCTG
TAATAAGGTGTTTCCACCAAATTATACCCTCCCACCCTGCAACGAGTAACCCTGATGTAATGGCANTTGATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan