ESTScan Details for Unigene SGN-U202056

Score 
208
Direction 
Reverse
Predicted Peptide Sequence 
MLSWKIGPTLACGNTIMLKTAEQTPLSAFYVANLLQETGLSEGILNIISGFATTADAPLRSHMDMDKVLNAGKNKLKSMDEVGGLVNLRA
XDFEWRVLTDP
Predicted Coding Sequence 
XXCATGCTTTCATGGAAGATTGGCCCTACTTTAGCTTGTGGCAACACAATCATGCTAAAGACAGCTGAGCAGACCCCATTATCTGCATTC
TATGTAGCAAATCTTCTGCAAGAGACTGGGCTATCTGAAGGTATTCTAAATATCATTTCGGGTTTTGCTACCACAGCTGATGCTCCTCTC
CGAAGTCATATGGATATGGATAAGGTACTGAATGCCGGAAAAAATAAGCTCAAATCTATGGACGAGGTCGGTGGTCTTGTGAACTTGCGT
GCAXCTGATTTTGAATGGAGAGTACTTACAGATCCTTGA\
Edits in Original Sequence 
(5')XXCATGCTTTCATGGAAGATTGGCCCTACTTTAGCTTGTGGCAACACAATCATGCTAAAGACAGCTGAGCAGACCCCATTATCTGC
ATTCTATGTAGCAAATCTTCTGCAAGAGACTGGGCTATCTGAAGGTATTCTAAATATCATTTCGGGTTTTGCTACCACAGCTGATGCTCC
TCTCCGAAGTCATATGGATATGGATAAGGTACTGAATGCCGGAAAAAATAAGCTCAAATCTATGGACGAGGTCGGTGGTCTTGTGAACTT
GCGTGCAXCTGATTTTGAATGGAGAGTACTTACAGATCCTTGA\(3')TAATGCCAGTTGGTTAGAAGCACTTCCTCCCCTGAAGCAAGA
TACAATTCCGTGTGTTTCATTTCAAAAGATTTTAACGAGAAACTACTCTGTTTGACGACTCTATCACAGGCACTAACATTGTAATATTAA
GCATAAACACAAAATTTTAATGTCTACATTCAATGGTGTTTTTCTACAATTGTTGTGATATTGTTATATTACTGAATCACTATTCAAAGC
ATCAAAACATTATAAAATGTAAATGTTGGGCCCGTGGGCCAGTATTCATCTAGTTATATTCATCTAGTTATATAGAAGAGTCGGTTATGG
GACAACCAAGGGCATTATAGTCATTTCACAATAAAAATTCACCATCCAAAATTCATCTCAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan