ESTScan Details for Unigene SGN-U202080

Score 
280
Direction 
Forward
Predicted Peptide Sequence 
GKTYNFLINSPFIIMSQTVVLKVGMSCEGCVGAVKRVLGKMEGVETFDIDLKEQKVTVKGNVQPDAVLKTVSKTGKPSSFWEAGETAKTE
AVXYSLTVSNGLELYVTARALCDIVKDSCNS
Predicted Coding Sequence 
XXTGGAAAAACCTACAACTTTCTTATCAATTCACCCTTCATCATCATGTCTCAGACTGTTGTTCTCAAGGTTGGCATGTCATGCGAAGGC
TGTGTCGGGGCTGTGAAAAGGGTCTTGGGGAAAATGGAAGGTGTAGAAACTTTCGACATTGATCTGAAGGAGCAAAAAGTGACGGTGAAG
GGCAATGTTCAACCAGACGCTGTTCTCAAGACCGTTTCAAAGACCGGAAAGCCATCTTCGTTCTGGGAAGCAGGAGAAACGGCTAAAACA
GAAGCTGTTAXGTACAGCTTGACGGTGTCTAATGGCCTCGAATTGTATGTTACGGCTAGAGCTTTATGCGACATCGTCAAGGATTCCTGT
AATAGTTAA\
Edits in Original Sequence 
(5')XXTGGAAAAACCTACAACTTTCTTATCAATTCACCCTTCATCATCATGTCTCAGACTGTTGTTCTCAAGGTTGGCATGTCATGCGA
AGGCTGTGTCGGGGCTGTGAAAAGGGTCTTGGGGAAAATGGAAGGTGTAGAAACTTTCGACATTGATCTGAAGGAGCAAAAAGTGACGGT
GAAGGGCAATGTTCAACCAGACGCTGTTCTCAAGACCGTTTCAAAGACCGGAAAGCCATCTTCGTTCTGGGAAGCAGGAGAAACGGCTAA
AACAGAAGCTGTTAXGTACAGCTTGACGGTGTCTAATGGCCTCGAATTGTATGTTACGGCTAGAGCTTTATGCGACATCGTCAAGGATTC
CTGTAATAGTTAA\(3')TATCTAAATCGCAATAATTGTCAAGGATTTCGATGTTGTTTTCTTCGATGTAGATGGAGTGTCGTTAATGCA
TTAGTTATACTAGAATTGCCTCTGCAGATGATATTGTTGTGATTTAATTCTGCCTTAAGGGACTCTTGAAAGTTCGTCTTTTGTATTGCG
TCGAGAGAAATGACATCGATGCATTGGAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan