ESTScan Details for Unigene SGN-U202181

Score 
392
Direction 
Forward
Predicted Peptide Sequence 
MDKXPEMDIFNKKLVFWTTLFAGTLLFMCFHSHPPSGSQTVYPKVKWDGNPQWEKRVKLSARSRSGHFSVLVTGAAGFVGSHVSAALKRR
GDGVVGLDNFNSYYDPSLKRARQKLLEEKGVSVIEGDINENKLLKKLFDIVAFTPRNAFAAQAGVRYAMKNPAPYIHSNIAG
Predicted Coding Sequence 
ATGGACAAGXCACCGGAGATGGACATATTCAATAAGAAGCTTGTCTTTTGGACCACCCTTTTTGCAGGTACCCTTCTTTTCATGTGTTTC
CACTCTCATCCTCCGTCTGGTTCTCAAACCGTTTATCCCAAAGTGAAATGGGATGGGAACCCACAATGGGAAAAGCGGGTAAAACTTTCT
GCCCGTTCACGTTCCGGTCATTTCTCCGTACTTGTTACCGGCGCCGCCGGTTTCGTTGGGTCCCATGTCTCCGCCGCCCTCAAACGCCGT
GGTGATGGCGTCGTTGGACTCGACAATTTCAACAGCTATTACGACCCGTCGTTGAAAAGAGCCCGTCAGAAACTGTTGGAAGAGAAAGGG
GTTTCCGTCATTGAAGGAGATATCAATGAGAATAAACTGCTTAAAAAGCTTTTCGACATTGTTGCATTTACCCCACGTAATGCATTTGCT
GCACAGGCCGGCGTCCGTTACGCGATGAAGAATCCTGCTCCTTACATCCACAGCAATATAGCAGGT\
Edits in Original Sequence 
AATTTAGCCATCAATTGTGTGAGAGAGCGGGAAAAAAAAATGAAC(5')ATGGACAAGXCACCGGAGATGGACATATTCAATAAcGAAGC
TTGTCTTTTGGACCACCCTTTTTGCAGGTACCCTTCTTTTCATGTGTTTCCACTCTCATCCTCCGTCTGGTTCTCAAACCGTTTATCCCA
AAGTGAAATGGGATGGGAACCCACAATGGGAAAAGCGGGTAAAACTTTCTGCCCGTTCACGTTCCGGTCATTTCTCCGTACTTGTTACCG
GCGCCGCCGGTTTCGTTGGGTCCCATGTCTCCGCCGCCCTCAAACGCCGTGGTGATGGCGTCGTTGGACTCGACAATTTCAACAGCTATT
ACGACCCGTCGTTGAAAAGAGCCCGTCAGAAACTGTTGGAAGAGAAAGGGGTTTCCGTCATTGAAGGAGATATCAATGAGAATAAACTGC
TTAAAAAGCTTTTCGACATTGTTGCATTTACCCCACGTAATGCATTTaGCTGCACAGGCCGGCGTCCGTTACGCGATGAAGAATCCTGCT
CCTTACATCCACAGCAATATAGCAGGT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan