ESTScan Details for Unigene SGN-U202226

Score 
144
Direction 
Forward
Predicted Peptide Sequence 
NLTSPVNQDSGELRHPHSSPXLKIEIWMFFGDNIVGGIAAVLIVIPRLRSKSDQPEKVASKPQNKGVQTYSKAEVALHNKRTDCWIIIKD
KVFDVTSYVEEHPGGDAILDHAGDDSTEGFYGPQHATRVFEMIDDFCIGNLEKVIAYSVDCYGNVHLQRNLRKLACCMIKHPYLCLRRPI
VRLLILKFCX
Predicted Coding Sequence 
XTGAATCTCACTTCGCCGGTAAATCAAGATTCCGGTGAGCTCCGGCATCCACATTCGTCGCCGAXGCTAAAAATTGAGATATGGATGTTC
TTTGGCGACAATATTGTTGGGGGTATTGCTGCTGTGCTCATTGTTATACCTCGACTTCGTAGTAAATCTGATCAGCCCGAAAAGGTTGCC
TCAAAACCTCAGAACAAGGGAGTCCAAACATATAGCAAAGCTGAAGTTGCGTTGCATAACAAGAGAACTGATTGCTGGATTATTATCAAA
GATAAGGTGTTTGATGTTACCTCGTATGTCGAAGAACACCCTGGGGGTGATGCCATCCTAGATCATGCCGGTGATGATTCGACTGAAGGT
TTCTATGGGCCGCAACATGCTACACGAGTATTTGAAATGATTGATGACTTCTGCATCGGAAATCTGGAAAAAGTAATTGCTTACTCCGTT
GATTGCTATGGAAATGTTCATCTGCAACGAAATTTAAGGAAGCTCGCGTGCTGCATGATAAAGCATCCATATTTATGTCTACGACGACCT
ATTGTTCGCCTTCTTATACTCAAGTTCTGCAXX\
Edits in Original Sequence 
(5')XTGAATCTCACTTCGCCGGTAAATCAAGATTCCGGTGAGCTCCGGCATCCACATTCGTCGCCGAXGCTAAAAATTGAGATATGGAT
GTTaCTTTGGCGACAATATTGTTGGGGGTATTGCTaGCTGTGCTCATTGTTATACCTCGACTTCGTAGTAAATCTGATCAGCCCGAAAAG
GTTGCCTCAAAACCTCAGAACAAGGGAGTCCAAACATATAGCAAAGCTGAAGTTGCGTTGCATAACAAGAGAACTGATTGCTGGATTATT
ATCAAAGATAAGGTGTTTGATGTTACCTCGTATGTCGAAGAACACCCTGGGGGTGATGCCATCCTAGATCATGCCGGTGATGATTCGACT
GAAGGTTTCTATGGGCCGCAACATGCTACACGAGTATTTGAAATGATTGATGACTTCTGCATCGGAAATCTGGAAAAAGTAATTGCTTAC
TcCCGTTGATTGCTATGGAAATGTTCATCTGCAACGAAATTTAAGGAgAGCTCGCGTGCTGCATGATAAAGCATCCATATTTATGTCTAC
GACGACCTATTGTTCGCCTTCTTATACTCAAGTTCTGCAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan