ESTScan Details for Unigene SGN-U202287

Score 
40
Direction 
Forward
Predicted Peptide Sequence 
KTSYFEAINNKSLNKAIKVNKWILHSTGTIGLSQLALAIPQTSEEYQSNLSANNRPXVKPAAKVVQIPVHFVGSDTERAVLRKPEPDRSG
SALRIQKVFRGFLVRKCVKRIKTIKKEVEDVERKLLRRETAESICRDERERLRVNX
Predicted Coding Sequence 
AAAACATCATACTTTGAAGCAATCAATAACAAATCTCTCAACAAAGCAATCAAAGTTAACAAATGGATTCTCCATTCTACGGGAACTATC
GGTCTCAGCCAGCTCGCCCTCGCTATTCCTCAAACATCCGAGGAATACCAGTCGAATCTGTCCGCCAACAACCGGCCGXCAGTCAAACCG
GCGGCGAAGGTTGTTCAGATTCCGGTCCACTTCGTCGGGTCGGATACGGAGCGGGCTGTTTTACGGAAACCTGAGCCGGACCGGTCTGGT
TCAGCTTTGAGGATTCAGAAGGTATTCAGAGGGTTTCTGGTGAGAAAATGTGTGAAGAGGATTAAGACGATTAAGAAGGAGGTGGAGGAT
GTCGAGCGGAAGCTTCTGCGTAGGGAAACGGCGGAGTCGATTTGTAGAGATGAAAGGGAGAGGTTGCGGGTGAATGXX\
Edits in Original Sequence 
(5')AAAACATCATACTTTGtAAGCAATCAATAACAAATCTCTCAACAAAGCAATCAAAGTTAACAAATGGATTCTCCATTCTACGGGAA
CTATCGGTCTCAGCCAGCTCGCCCTCGCTATTCCTCAAACATCCGAGGAATACCAGTCGAATCTGTCCGCCAACAACCGGCCGXCAGTCA
AACCGGCGGCGAAGGTTGTTCAGATTCCGGTCCACTTCGTCGGGTCGGATACGGAGCGGGCTGTTTTACGGAAACCTGAGCCGGACCGGT
CTGGTTCAGCTTTGAGGATTCAGAAGGTATTCAGAGGGTTTCTGGTGAGAAAATGTGTGAAGAGGATTAAGACGATTAAGAAGGAGGTGG
AGGATGTCGAGCGGAAGCTTCTGCGTAGGGAAACGGCGGAGTCGATTTGTAGAGATGAAAGGGAGAGGTTGCGGGTGAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan