ESTScan Details for Unigene SGN-U202402

Score 
512
Direction 
Forward
Predicted Peptide Sequence 
VSPDPLTRLIPTSILLLLELVXGFLALPHSPPSETEDARIVREFAELVDASEAYLALNGEESSDTQPEEKHVAATISERFMGMKAAVITE
NLRLKSFCHKLGFTVLELNEVISTINNQVDSSVLPSELFKLMGFQEGKILESNQFDLVILHVGAGQTTNCLKDLDH
Predicted Coding Sequence 
GTTAGCCCXGATCCATTGACCCGTCTCATACCCACCTCCATTCTTTTGCTTCTCGAGCTTGTTGXTGGCTTCTTGGCTCTTCCTCACTCT
CCTCCTTCAGAAACTGAGGATGCAAGAATAGTCAGAGAATTTGCTGAGCTAGTGGATGCAAGTGAAGCTTATCTTGCCCTGAACGGGGAA
GAATCTTCTGACACTCAACCTGAGGAGAAGCATGTAGCAGCAACCATATCAGAGAGGTTTATGGGGATGAAAGCTGCTGTCATCACTGAG
AATTTAAGACTGAAGAGTTTCTGTCATAAGCTTGGCTTCACTGTCTTAGAGCTCAATGAGGTGATTAGTACCATTAACAACCAGGTTGAT
TCATCCGTCTTACCTTCTGAATTGTTCAAGTTGATGGGTTTTCAAGAAGGGAAGATCTTAGAGTCAAACCAATTTGATTTGGTTATTCTT
CACGTTGGAGCTGGTCAAACGACAAATTGCCTCAAAGACTTGGATCAT\
Edits in Original Sequence 
(5')GTTAGCCCXGATCCATTGACCCGTCTCATACCCACCTCCATTCTTTTGCTTCTCGAGCTTGTTGXTGGCTTCTTGGCTCTTCCTCA
CTCTCCTCCTTCAGAAACTGAGGATGCAAGAATAGTCAGAGAATTTGCTGAGCTAGTGGATGCAAGTGAAGCTTATCTTGCCCTGAACGG
GGAAGAATCTTCTGACACTCAACCTGAGGAGAAGCATGTAGCAGCAACCATATCAGAGAGGTTTATGGGGATGAAAGCTGCTGTCATCAC
TGAGAATTTAAGACTGAAGAGTTTCTGTCATAAGCTTGGCTTCACTGTCTTAGAGCTCAATGAGGTGATTAGTACCATTAACAACCAGGT
TGATTCATCCGTCTTACCTTCTGAATTGTTCAAGTTGATGGGTTTTCAAGAAGGGAAGATCTTAGAGTCAAACCAATTTGATTTGGTTAT
TCTTCACGTTGGAGCTGGTCAAACGACAAATTGCCTCAAAGACTTGGATCAT\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan