ESTScan Details for Unigene SGN-U202435

Score 
704
Direction 
Forward
Predicted Peptide Sequence 
MEIPVIDFSKLEGDERSATMGLLHQACEKWGFFMIENHGIDIYLMDNVKQLVNQHYEANMKKRFYESEVSISLQKKENISNTDWESTFFV
WHRPSSNIYEIQGLSKELCKAVDAYIDQLIELAENLSELMCENLGLEKSYIKEAFSRSKGPSVGTKVAIYPQCPRPDLLRGLREXTDAGG
IILLLQDEQVPGLEFXKDGX
Predicted Coding Sequence 
ATGGAGATTCCGGTAATCGACTTCAGCAAGCTTGAAGGTGACGAGAGAAGTGCAACCATGGGACTTCTCCATCAGGCTTGTGAGAAATGG
GGTTTCTTTATGATAGAGAACCATGGAATTGACATTTACTTGATGGACAATGTGAAGCAGCTGGTGAATCAGCACTATGAAGCTAACATG
AAGAAACGGTTCTATGAATCAGAGGTATCTATAAGCTTACAGAAGAAAGAAAATATCAGCAACACAGACTGGGAAAGCACATTCTTTGTT
TGGCATCGTCCAAGTTCCAACATCTATGAGATTCAAGGTCTCTCAAAGGAACTTTGCAAAGCAGTAGATGCCTACATTGATCAGCTGATC
GAACTTGCAGAAAATCTTTCAGAACTAATGTGTGAGAACCTTGGCCTAGAGAAGAGTTACATCAAAGAAGCATTTTCACGGAGCAAGGGT
CCTTCTGTTGGAACAAAAGTGGCAATATATCCTCAATGTCCTCGTCCTGATCTACTCAGGGGATTGCGCGAGCANACAGATGCTGGTGGT
ATCATTCTCTTACTCCAAGACGAACAAGTTCCTGGCCTTGAATTCTTNAAAGACGGACAX\
Edits in Original Sequence 
AAAAG(5')ATGGAGATTCCGGTAATCGACTTCAGCAAGCTTGAAGGTGACGAGAGAAGTGCAACCATGGGACTTCTCCATCAGGCTTGT
GAGAAATGGGGTTTCTTTATGATAGAGAACCATGGAATTGACATTTACTTGATGGACAATGTGAAGCAGCTGGTGAATCAGCACTATGAA
GCTAACATGAAGAAACGGTTCTATGAATCAGAGGTATCTATAAGCTTACAGAAGAAAGAAAATATCAGCAACACAGACTGGGAAAGCACA
TTCTTTGTTTGGCATCGTCCAAGTTCCAACATCTATGAGATTCAAGGTCTCTCAAAGGAACTTTGCAAAGCAGTAGATGCCTACATTGAT
CAGCTGATCGAACTTGCAGAAAATCTTTCAGAACTAATGTGTGAGAACCTTGGCCTAGAGAAGAGTTACATCAAAGAAGCATTTTCACGG
AGCAAGGGTCCTTCTGTTGGAACAAAAGTGGCAATATATCCTCAATGTCCTCGTCCTGATCTACTCAGGGGATTGCGCGAGCANACAGAT
GCTGGTGGTATCATTCTCTTACTCCAAGACGAACAAGTTCCTGGCCTTGAATTCTTNAAAGACGGACAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan