ESTScan Details for Unigene SGN-U202454

Score 
462
Direction 
Forward
Predicted Peptide Sequence 
SLDLLGILVVDLKRGWDILDLEMEPVRFTLGKQSSLAPERVVEAVEIESEDGEEGDVIDIDPRIRLMYSANEGDIEGIKELLGSGTDVNF
RDDDERTALHVAASQGYSDVVQLLLDNGAEIDSKDRWGSTPLGDAIHYKNHHVIKLLEEHGAKPAMAPM
Predicted Coding Sequence 
TCATTAGACCTGTTAGGTATATTGGTTGTAGATCTTAAAAGGGGTTGGGATATTCTTGATCTTGAAATGGAACCAGTAAGATTTACATTG
GGTAAGCAATCGTCCCTTGCACCAGAAAGGGTGGTTGAGGCAGTGGAAATTGAGAGTGAAGATGGGGAAGAAGGGGATGTTATAGATATT
GATCCAAGGATTAGGTTGATGTATTCAGCTAATGAGGGTGATATAGAGGGGATCAAGGAGCTATTGGGTTCAGGAACTGATGTAAATTTT
CGAGACGATGATGAGAGGACTGCTTTACATGTTGCTGCTAGCCAAGGTTACAGTGATGTTGTGCAGCTGTTGCTTGATAATGGGGCTGAA
ATTGATTCCAAAGATCGATGGGGAAGCACGCCTCTTGGAGATGCAATACATTATAAAAATCATCATGTGATCAAGCTACTGGAGGAACAT
GGCGCCAAGCCTGCTATGGCTCCCATG\
Edits in Original Sequence 
GCAAGATTGCCCTTTTGCCATCTTTGGATTCTTGAAAAAGTTTTAGTTTGAAAAAAACAATAAGTTTTGGTGGCACCCTTTATGCAGATT
TTGGATTCTTGAAAAGATTTAGTCTTTTTCCTTGTTTTGAGATTCTGAAGGTGTTGAATTCTTTAG
(5')TCATTAGACCTGTTAGGTAT
ATTGGTTGTAGATCTTAAAAGGGGTTGGGATATTCTTGATCTTGAAATGGAACCAGTAAGATTTACATTGGGTAAGCAATCGTCCCTTGC
ACCAGAAAGGGTGGTTGAGGCAGTGGAAATTGAGAGTGAAGATGGGGAAGAAGGGGATGTTATAGATATTGATCCAAGGATTAGGTTGAT
GTATTCAGCTAATGAGGGTGATATAGAGGGGATCAAGGAGCTATTGGGTTCAGGAACTGATGTAAATTTTCGAGACGATGATGAGAGGAC
TGCTTTACATGTTGCTGCTAGCCAAGGTTACAGTGATGTTGTGCAGCTGTTGCTTGATAATGGGGCTGAAATTGATTCCAAAGATCGATG
GGGAAGCACGCCTCTTGGAGATGCAATACATTATAAAAATCATCATGTGATCAAGCTACTGGAGGAACATGGCGCCAAGCCTGCTATGGC
TCCCATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan