ESTScan Details for Unigene SGN-U202529

Score 
796
Direction 
Reverse
Predicted Peptide Sequence 
KVKDKVDSKETGEGNMSAEIASPLGESATPPVKTFTRKKIVKKVPMVKTPTEDGLKPPDIGIVKEAESSEDKVNSKTGGDSTSVKQDAVV
KQDTVVKKTVKRKIIKRVPKRKAASTDTNNGVTGVGSLKDDVKEEKLVQAKSEVQNVGNNNAENAVCVNVVNQEQKVSPKTKSKIADVKQ
ETKEEINLDGSKKVSKTDKLKGKEDPKETAAX
Predicted Coding Sequence 
AAAGTGAAGGATAAGGTGGATAGTAAAGAAACTGGGGAAGGAAATATGAGCGCAGAGATTGCTTCTCCGCTTGGAGAATCTGCTACCCCT
CCAGTTAAAACTTTTACAAGGAAGAAAATCGTAAAGAAGGTTCCCATGGTGAAAACTCCAACAGAAGATGGGTTGAAACCTCCTGATATA
GGAATTGTCAAGGAGGCGGAATCTTCAGAAGATAAGGTGAATAGTAAAACTGGTGGCGATAGTACGTCTGTCAAGCAGGATGCTGTTGTC
AAGCAGGACACTGTTGTGAAGAAAACAGTTAAGAGAAAAATAATTAAGAGGGTTCCCAAACGAAAAGCAGCATCTACAGACACCAACAAT
GGGGTCACTGGTGTTGGTAGTCTCAAAGATGATGTGAAAGAGGAGAAATTAGTTCAAGCTAAAAGTGAGGTGCAAAATGTGGGTAATAAT
AATGCAGAAAATGCAGTGTGTGTGAATGTTGTCAACCAAGAACAGAAGGTTAGCCCGAAAACAAAATCAAAAATAGCTGACGTGAAGCAA
GAGACTAAAGAAGAGATAAATCTTGATGGATCCAAGAAAGTGTCCAAAACAGACAAGCTAAAAGGAAAGGAAGACCCCAAAGAAACAGCG
GCCGXX\
Edits in Original Sequence 
(5')AAAGTGAAGGATAAGGTGGATAGTAAAGAAACTGGGGAAGGAAATATGAGCGCAGAGATTGCTTCTCCGCTTGGAGAATCTGCTAC
CCCTCCAGTTAAAACTTTTACAAGGAAGAAAATCGTAAAGAAGGTTCCCATGGTGAAAACTCCAACAGAAGATGGGTTGAAACCTCCTGA
TATAGGAATTGTCAAGGAGGCGGAATCTTCAGAAGATAAGGTGAATAGTAAAACTGGTGGCGATAGTACGTCTGTCAAGCAGGATGCTGT
TGTCAAGCAGGACACTGTTGTGAAGAAAACAGTTAAGAGAAAAATAATTAAGAGGGTTCCCAAACGAAAAGCAGCATCTACAGACACCAA
CAATGGGGTCACTGGTGTTGGTAGTCTCAAAGATGATGTGAAAGAGGAGAAATTAGTTCAAGCTAAAAGTGAGGTGCAAAATGTGGGTAA
TAATAATGCAGAAAATGCAGTGTGTGTGAATGTTGTCAACCAAGAACAGAAGGTTAGCCCGAAAACAAAATCAAAAATAGCTGACGTGAA
GCAAGAGACTAAAGAAGAGATAAATCTTGATGGATCCAAGAAAGTGTCCAAAACAGACAAGCTAAAAGGAAAGGAAGACCCCAAAGAAAC
AGCGGCCGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan