ESTScan Details for Unigene SGN-U202787

Score 
81
Direction 
Forward
Predicted Peptide Sequence 
SFALLTAVATLSTLLRQDVSKRTDGAGPEQVGYNTAASTFSGSNFSVRLRLTLVPIGHVAHGKSTVVKAISGVHTVRSKNELERNITIKL
G
Predicted Coding Sequence 
XXCTCATTTGCACTCTTGACGGCTGTCGCCACCCTTTCCACCTTACTCCGCCAAGATGTCTCGAAAAGGACTGATGGAGCAGGACCTGAG
CAAGTTGGATACAACACAGCTGCATCCACTTTCTCCGGAAGTAATTTCTCXGTNAGGCTACGATTAACATTGGTACCCATTGGCCATGTG
GCTCACGGAAAGTCAACAGTTGTAAAAGCTATATCCGGTGTGCACACTGTTCGTTCCAAGAATGAGCTAGAGCGTAACATTACCATCAAG
CTTGGX\
Edits in Original Sequence 
(5')XXCTCATTTGCACTCTTGACGGCTGTCGCgCACCCTTTCCACCTTACTCCGCCAAGATGTCTCGAAAAGGACTGATGGAGCAGGAC
CTGAGCAAGTTGGATACAACACAGCTGCATCCACTTTCTCCGGAAGTAATTTCTCXGTNAGGCTACGATTAACATTGGTACCCATTGGCC
ATGTGGCTCACGGAAAGTCAACAGTTGTAAAAGCTATATCCGGTGTGCACACTGTTCGTTCCAAGAATGAGCTAGAGCGTAACATTACCA
TCAAGCTTGGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan