ESTScan Details for Unigene SGN-U202823

Score 
407
Direction 
Forward
Predicted Peptide Sequence 
MLGLRFVAERTGDGAGQPFVDADNGEELMHVQPGTTIVLGSRPPESPGTLYITTKQVVWLSDTDRSEGYAVDFLSVSLHAVSRDPEAYPD
SCLYAQIDNGVEDDESEGSSDEGAESSDLSRITELRLVPTDPNQVDTLFQIFCECAXPYPEPIEQEEX
Predicted Coding Sequence 
ATGTTAGGCTTGAGGTTTGTTGCTGAAAGAACCGGTGATGGCGCCGGGCAGCCATTCGTCGACGCCGACAACGGCGAGGAACTGATGCAT
GTTCAGCCTGGAACTACCATAGTCCTCGGCAGCCGCCCTCCTGAGTCCCCTGGCACTCTCTATATAACCACCAAGCAAGTGGTGTGGCTA
AGTGATACAGATAGGAGTGAAGGTTATGCTGTTGATTTTCTGTCGGTTTCACTTCATGCTGTTTCTAGAGACCCCGAGGCTTATCCCGAT
TCTTGTTTATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGCTCCAGTGATGAGGGTGCTGAGTCATCCGATTTATCA
AGGATCACCGAGTTGAGACTTGTGCCAACAGATCCTAATCAAGTGGATACTCTATTCCAAATCTTTTGTGAGTGTGCTGAXCCTTATCCT
GAACCAATTGAACAGGAGGAAGAX\
Edits in Original Sequence 
CTAAAACCCTAGAGCAGCAGTAGTCTAGCAGAGTCTCTACTCTTTAAGTCTCCCCAATCTTTTTGCCGACCGGAAACT(5')ATGTTAGG
CTTGAGGTTTGTTGCTGAAAGAACCGGTGATGGCGCCGGGCAGCCATTCGTCGACGCCGACAACGGCGAGGAACTGATGCATGTTCAGCC
TGGAACTACCATAGTCCTCGGCAGCCGCCCTCCTGAGTCCCCTGGCACTCTCTATATAACCACCAAGCAAGTGGTGTGGCTAAGTGATAC
AGATAGGAGTGAAGGTTATGCTGTTGATTTTCTGTCGGTTTCACTTCATGCTGTTTCTAGAGACCCCGAGGCTTATCCCGATTCTTGTTT
ATATGCTCAGATTGACAATGGAGTGGAGGATGACGAATCAGAAGGCTCCAGTGATGAGGGTGCTGAGTCATCCGATTTATCAAGGATCAC
CGAGTTGAGACTTGTGCCAACAGATCCTAATCAAGTGGATACTCTATTCCAAATCTTTTGTGAGTGTGCTGAXCCTTATCCTGAACCAAT
TGAACAGGAGGAAGAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan