Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U202920

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
MDDELKKAESHTTSAAAFVEGGIQDACDDAAAFVLRLSAKVILRRSQAASMNSPPVHPRMASEKFNCPMCWQPLSLKDPTSQELLEAVEQ
ERTLRFNQARNX
Predicted Coding Sequence 
ATGGACGACGAGCTCAAGAAAGCGGAGAGTCATACCACATCAGCTGCAGCTTTTGTGGAAGGAGGAATTCAAGATGCCTGTGATGATGCT
GCAGCATTTGTCTTGAGGCTTTCTGCGAAAGTGATCCTTCGACGCTCACAAGCTGCAAGCATGAATTCACCTCCAGTGCATCCTAGAATG
GCATCAGAGAAGTTCAATTGTCCAATGTGTTGGCAGCCCCTGAGTCTGAAAGATCCTACGAGTCAAGAATTGCTTGAGGCTGTGGAACAA
GAGAGGACTCTTAGGTTTAATCAGGCCAGAAATGXX\
Edits in Original Sequence 
ATTTCTTTAATTTATGTTTTTCATGGCAGAAAATATCAGACCTTTAATTTTTCTAATTTATGGCATATTTTTCTCATCCATTTGACCCAT
TTTCAAGAACATTTATCTGATTCTCTTTTTTTGAGCTAGTAGGACTGTCATGAGATAAGGTTCTGGAA
(5')ATGGACGACGAGCTCAAG
AAAGCGGAGAGTCATACCACATCAGCTGCAGCTTTTGTGGAAGGAGGAATTCAAGATGCCTGTGATGATGcCTGCAGCATTTGTCTTGAG
GCTTTCTGCGAAAGTGATCCTTCGACGCTCACAAGCTGCAAGCATGAAtTTCACCTCCAGTGCATCCTAGAATGGCATCAGAGAAGTTCt
AATTGTCCAATGTGTTGGCAGCCCCTGAGTCTGAAAGATCCTACGAGTCAAGAATTGCTTGAGGCTGTGGAACAAGAGAGGACTCTTAGG
TTTAATCAGGCCAGAAATGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan