ESTScan Details for Unigene SGN-U202935

Score 
373
Direction 
Forward
Predicted Peptide Sequence 
ERDNILRCPVCLHHAGYVNEGYRYFKCMKETWGVEPRIEHYGCMVDMLSRAGLFDEAVMLVETMPMKPNEAVWGALLGGCKIHKNLRLAS
SVAQKLTVELEPDRAAGYFVPLSNLYATDKRWQDVIITRQKMFGMRVTKPPGQRKIEADGTIX
Predicted Coding Sequence 
GAACGAGATAACATTCTTAGGTGTCCTGTTTGCTTGCATCATGCTGGTTATGTCAATGAGGGGTACCGATACTTTAAATGTATGAAAGAA
ACTTGGGGTGTGGAGCCAAGGATTGAGCATTATGGCTGCATGGTTGACATGCTAAGTCGTGCTGGACTTTTTGATGAAGCTGTCATGCTT
GTTGAGACAATGCCTATGAAGCCAAATGAGGCTGTTTGGGGTGCTCTTCTTGGAGGATGCAAGATACACAAAAATCTGAGACTAGCTTCC
AGCGTAGCTCAAAAATTGACCGTGGAGCTTGAACCTGATAGAGCTGCTGGCTACTTTGTGCCGTTGTCAAATCTATATGCCACTGATAAG
AGGTGGCAAGATGTTATCATCACGAGACAGAAGATGTTTGGAATGCGAGTAACAAAGCCTCCAGGTCAAAGAAAAATTGAAGCTGATGGT
ACCATTCAX\
Edits in Original Sequence 
(5')GAACGAGATAACATTCTTAGGTGTCCTGTTTGCTTGCAgTCATGCTGGTTATGTCAATGAGGGGTACCGATACTTTAAATGTATGA
AAGAAACTTGGGGTGTGGAGCCAAGGATTGAGCATTATGGCTGCATGGTTGACATGCTAAGTCGTGCTGGACTTTTTGATGAAGCTGTCA
TGCTTGTTGAGACAATGCCTATGAAGCCAAATGAGGCTGTTTGGGGTGCTCTTCTTGGAGGATGCAAGATACACAAAAATCTGAGACTAG
CTTCCAGCGTAGCTCAAAAATTGACCGTGGAGCTTGAACCTGATAGAGCTGCTGGCTACTTTGTGCCGTTGTCAAATCTATATGCCACTG
ATAAGAGGTGGCAAGATGTTATCATCACGAGACAGAAGATGTTTGGAATGCGAGTAACAAAGCCTCCAGGTCAAAGAAAAATTGAAGCTG
ATGGTACCATTCAX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan