ESTScan Details for Unigene SGN-U202988

Score 
343
Direction 
Forward
Predicted Peptide Sequence 
MENHQFIYPILVSLITALGLVSISLCIAAEFKKTKKKDLRFDGKWCYLPGSVAFELGIGAXNLFINCTSDWELVDMYNLLLKGPSNSSKP
NKKPTFNSLICVLSWMSFVMGIILIGTSISM
Predicted Coding Sequence 
ATGGAAAATCACCAATTCATATACCCAATTCTTGTCTCCCTTATCACTGCCCTTGGCCTTGTTTCCATCTCTCTATGCATAGCTGCTGAA
TTCAAGAAAACAAAGAAGAAAGATCTCAGGTTTGATGGAAAATGGTGTTACTTGCCAGGAAGTGTGGCCTTTGAATTGGGGATTGGAGCT
XTTAATTTGTTTATTAATTGCACAAGTGATTGGGAACTTGTTGATATGTACAATTTGCTTCTCAAGGGACCATCAAACAGTTCAAAGCCT
AACAAGAAGCCTACCTTTAACAGCCTCATTTGTGTTCTTTCATGGATGAGCTTTGTGATGGGAATAATTTTGATAGGAACTAGCATTAGC
ATG\
Edits in Original Sequence 
TTTCTACTTTGCCCCCTTCTCTCTTTTGCTCTCTCTTTATTCTCTCATTGAAACACAACCCCATAAAGAGAAGAAAAAAAAAAGTGTT(5')
ATGGAAAATCACCAATTCATATACCCAATTCTTGTCTCCCTTATCACTGCCCTTGGCCTTGTTTCCATCTCTCTATGCATAGCTGCTG
AATTCAAGAAAACAAAGAAGAAAGATCTCAGGTTTGATGGAAAATGGTGTTACTTGCCAGGAAGTGTGGCCTTTGAATTGGGGATTGGAG
CTXTTAATTTGTTTATTAATTGCACAAGTGATTGGGAACTTGTTGATATGTACAATTTGCTTCTCAAGGGACCATCaAAACAGTTCAAAG
CCTAACAAGAAGCCTACCTTTAACAGCCTCATTTGTGTTCTTTCATGGATGAGCTTTGTGATGGGAATAATTTTGATAGGAACTAGCATT
AGCATG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan