ESTScan Details for Unigene SGN-U203063

Score 
309
Direction 
Reverse
Predicted Peptide Sequence 
AKNEDGDQRHHHRMGHHXPYPPSRGGATGGXDKIFVLELLILGKEEEELLIEKPXPPTRPPVLAADAGSTDPSVKTPAATATNANSGKFI
FTFPQRVLWVIWAVLRQDFSAMYPNEGIIXFWVCMLEKEEQLGNFAVEKLQTSFLHFKLVENMDAPEFX
Predicted Coding Sequence 
XGTGCGAAGAATGAGGATGGTGACCAGCGCCACCACCATAGAATGGGACACCATAGXCCATATCCACCAAGTAGAGGAGGAGCAACTGGT
GGAXTTGATAAGATATTTGTTCTTGAATTGTTGATTCTTGGTAAGGAAGAGGAGGAGCTGTTGATCGAAAAGCCTGXACCACCAACTCGC
CCACCAGTCTTAGCAGCTGATGCTGGATCCACTGACCCCAGTGTCAAAACTCCAGCTGCCACTGCAACTAATGCTAACTCXGGCAAATTT
ATTTTCACTTTTCCACAAAGAGTCTTGTGGGTCATCTGGGCTGTGCTTAGACAAGATTTTAGTGCTATGTACCCGAACGAAGGTATTATT
XTTTTCTGGGTTTGTATGTTAGAGAAAGAGGAGCAATTAGGAAACTTTGCTGTAGAAAAGCTACAGACATCTTTTTTGCACTTCAAGTTA
GTCGAAAATATGGATGCTCCCGAGTTCAGX\
Edits in Original Sequence 
(5')XGTGCGAAGAATGAGGATGGTGACCAGCGCCAtCCACCATAGAATGGGACACCATAGXCCATATCCACCAAGTAGAGGAGGAGCAA
CTGGTGGAXTTGATAtAGATATTTGTTCTTGAATTGTTGATTCTTGGTAAGGAAGAGcGAGGAGCTGTTGATCGAAAAGCCTGXACCACC
AACTCGCCCACCAGTCTTAGCAGCTGATGCTGGATCCACTGACCCCAGTGTCAAAACTCCAGCTGCCACTGCAACTAATGCTAACTCXGG
CAAATTTATTTTCACTTTTCCACAAAGAGTCTTGTGGGTCATCTGGGCTGTGCTTAGACAAGATTTTAGTGCTATGTACCCGAACGAAGG
TATTATTXTTTTCTGGGTTTGTATGTTAGAGAAAGAGGAGCAATTAGGAAACTTTGCTGTAGAAAAGCTACAGACATCTTTTTTGCACTT
CAAGTTAGTCGAAAATATGGATGCTCCCGAGTTCAGX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan