ESTScan Details for Unigene SGN-U203068

Score 
153
Direction 
Forward
Predicted Peptide Sequence 
VNNNTEEKSLLVMERYEIVKELGSGNSAVAKLVSDKKTKELFAVKFIERGQKIDEHVQREIMNHRSLKHPNILRFKEXIANTYSSSNSNG
VCGGRX
Predicted Coding Sequence 
GTCAATAACAACACTGAAGAAAAAAGTTTGTTGGTGATGGAGCGTTATGAGATTGTGAAAGAGTTGGGTTCTGGTAATTCTGCAGTAGCA
AAGCTTGTTAGTGACAAGAAGACCAAAGAGCTCTTTGCTGTTAAGTTTATTGAAAGAGGCCAAAAGATAGATGAACATGTGCAAAGGGAA
ATTATGAATCATAGATCATTGAAACATCCAAATATACTGAGATTTAAAGAGGXTATTGCTAACACCTACTCATCTAGCAATAGTAATGGA
GTATGCGGCGGGAGGAXX\
Edits in Original Sequence 
CCCAATAGACTATTAGCTAGTAGTTTTTCCAGTCTGACCTCAACTAAACCTCAGTATTTCTTTTGAATATTAGTATCATTTTTCTAA(5')
GTCAATAACAACACTGAAGAAAAAAGTTTGTTGGTGATGGAGCGTTATGAGATTGTGAAAGAGTTGGGTTCTGGTAATTCTGCAGTAGC
AAAGCTTGTTAGTGACAAGAAGACCAAAGAGCTCTTTGCTGTTAAGTTTATTGAAAGAGGCCAAAAGATAGATGAACATGTGCAAAGGGA
AATTATGAATCATAGATCATTGAAACATCCAAATATACTGAGATTTAAAGAGGXTATTGCTAACACCTACTCATCTAGCAATAGTAATGG
AGTATGCGGCGGGAGGAXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan