ESTScan Details for Unigene SGN-U203127

Score 
84
Direction 
Reverse
Predicted Peptide Sequence 
MIDDALERAGPHAAXREAESSITRQSNCNLSLSRTFLQHKLRTVLVLDLNDXDTFLGLHTILPTCYCLRKFSAEFLVQTSGLFASNMNME
QLQYYLHFSTHRVVFDIDTLDEAKTSSSFLLYNVSELHMRLVVSACSLIAFDAV
Predicted Coding Sequence 
ATGATAGATGATGCTCTGGAGAGGGCGGGGCCTCATGCTGCAGXTCGTGAGGCAGAATCCTCCATCACCAGGCAATCCAACTGCAATCTT
TCTCTGAGTAGAACATTTTTGCAGCATAAGTTACGAACAGTTCTTGTCTTAGACCTTAATGATGXTGATACTTTTCTAGGTCTTCACACC
ATTCTGCCTACATGCTATTGTTTGCGGAAGTTTTCTGCCGAGTTTTTGGTCCAAACTAGTGGTTTATTTGCTTCAAACATGAATATGGAA
CAACTGCAGTATTATCTGCACTTTAGTACTCATCGAGTAGTTTTCGACATCGACACTTTGGATGAAGCCAAGACATCTTCGAGTTTTTTA
TTGTACAATGTTTCCGAGTTGCATATGCGTTTAGTCGTTTCTGCTTGTAGCTTAATTGCTTTTGATGCTGTATAA\
Edits in Original Sequence 
(5')ATGATAGATGATGCTCTGGAGAGGGCGGGGCCTCATGCTGCAGXTCGTGAGGCAGAATCCTCCATCACCAGGCAATCCAACTGCAA
TCTTTCTCTGAGTAGAACATTTTTGCAGCATAAGTTACGAACAGTTCTTGTCTTAGACCTTAATGATGXTGATACTTTTCTAGGTCTTCA
CACCATTCTGCCTACATGCTATTGTTTGCGGAAGTTTTCTGCCGAGTTTTTGGTCCAAACTAGTGGTTTATTTGCTTCAAACATGAATAT
GGAACAACTGCAGTATTATCTGCACTTTAGTACTCATCGAGTAGTTaTTCGACATCGACACTTTGGATGAAGCCAAGACATCTTCGAGTT
TTTTATTGTACAATGTTTCCGAGTTGCATATGCGTTTAGTCGTTTCTGCTTGTAGCTTAATTGtCTTTTGATGCTGTATAA\(3')CTTG
TTCAAGCATCGATATGTTTTTGCTTTTTAGTTTTAGCCAATTTTCAGATTTTAAGCCCTTCCAATTATTCAGACCAAATTTGTAATTGCT
AGTCCCATTTTGTTAAAAGATTTATATATACTTCCCATTTCTTTCTTCTTAAACATTCAAAAAAAAAAAAAAAAAACTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan