ESTScan Details for Unigene SGN-U203134

Score 
239
Direction 
Reverse
Predicted Peptide Sequence 
YKFSHRIPAFRMSGTEKEGVPVGWFELDPAALPLNPDDIWYPGKLSRNAKSELENLTTPKNSVDLKGMCATGGESSKVRRSPRSLTISMT
RKL
Predicted Coding Sequence 
TACAAGTTCTCTCATCGAATCCCAGCATTCAGAATGAGTGGAACTGAAAAAGAGGGTGTACCTGTGGGATGGTTTGAACTTGATCCTGCT
GCTTTACCTCTTAATCCAGATGACATTTGGTACCCTGGGAAACTGAGCAGAAATGCAAAATCTGAACTGGAGAATTTGACAACACCTAAG
AATTCTGTGGACTTGAAAGGAATGTGTGCTACTGGTGGAGAGTCATCTAAGGTTCGGAGATCTCCTAGGAGTCTGACTATCTCCATGACT
AGAAAATTGTAG\
Edits in Original Sequence 
(5')TACAAGTTCTCTCATCGAATCCCAGCATTCAGAATGAGTGGAACTGAAAAAGAGGGTGTACCTGTGGGATcGGTTTGAACTTGATC
CTGCTGCTTTACCTCTTAATCCAGATGACATTTGGTACCCTGGGAAACTGAGCAGAAATGCAAAATCTGAACTGGAGAATTTGACAACAC
CTAAGAATTCTGTGGACTTGAAAGGAATGTGTGCTACTGGTGGAGAGTCATCTAAGGTTCGGAGATCTCCTAGGAGTCTGACTATCTCCA
TGACTAGAAAATTGTAG\(3')ACATGACAGATTCTTTTCTTCTGTTTTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan