ESTScan Details for Unigene SGN-U203160

Score 
214
Direction 
Forward
Predicted Peptide Sequence 
KXSGPRAEESAEATASSFSFSRSPNMTAALDNQMPVPLVSERPPSGIALQLPPQQIMGLNDVDLTDDGDGGGDGVGGEDKASAVSRSICL
EAVTDNGDDPGLSFNVDINFTLV
Predicted Coding Sequence 
AAAXCTAGTGGTCCCCGGGCTGAGGAATCGGCCGAGGCTACAGCTTCATCTTTCTCTTTTTCTCGCTCCCCAAATATGACCGCCGCGCTG
GACAATCAAATGCCGGTGCCGCTTGTCTCCGAGAGACCACCATCTGGAATAGCTCTTCAACTACCGCCACAGCAAATCATGGGATTGAAC
GATGTGGATCTTACGGATGATGGCGATGGAGGAGGAGATGGTGTTGGTGGAGAAGATAAGGCATCGGCGGTTTCGCGTTCGATTTGTCTT
GAAGCTGTAACCGACAATGGGGATGATCCTGGGTTAAGCTTCAATGTGGACATCAATTTCACCCTTGTTTAG\
Edits in Original Sequence 
(5')AAAXCTAGTGGTCCCCGGGCTGAGGAATCGGCCGAGGCTACAGCTTCATCTTTCTCTTTTTCTCGCTCCCCAtAATATGACCGCCG
CGCTGGACAATCAAATGCCGGTGCCGCTTGTCTCCGAcGAGACCACCATCTGGAATAGCTCTTCAACTACCGCCACAGCAAATCATGGGA
TTGAACGATGTGGATCTTACGGATGATGGCGATGGAGGAGGAGATGGTGTTGGTGGAGAAGATAAGGCATCGGCGGTTTCGCGTTCGATT
TGTCTTGAAGCTGTAACCGACAATGGGGATaGATCCTGGGTTAAGCTTCAATGTGGACATCAATTTCACCCTTGTTTAG\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan