ESTScan Details for Unigene SGN-U203253

Score 
336
Direction 
Reverse
Predicted Peptide Sequence 
GVSCVYSPSMRDPYKTLRIQPDASESDVRKAFRKLALQYHPDVCRGSNCDIQFNQINDAYDTVMSNLRGETKSAEIYEEYDDDESMRGVN
DPDWDMWEEWMGWEGAGIRDYSSHINPYI
Predicted Coding Sequence 
GGTGTTAGTTGTGTTTATTCACCATCTATGAGGGATCCTTATAAGACCTTGAGGATTCAACCTGATGCTTCTGAATCTGATGTCAGAAAG
GCTTTTAGAAAGCTTGCTCTTCAGTATCACCCAGATGTGTGCAGAGGAAGTAATTGTGACATCCAATTCAACCAAATCAATGACGCATAC
GATACTGTGATGAGTAACTTGAGAGGTGAAACGAAGAGTGCAGAGATATATGAGGAATATGATGATGATGAATCCATGAGAGGGGTAAAT
GATCCAGATTGGGATATGTGGGAAGAGTGGATGGGATGGGAAGGGGCCGGCATTCGCGACTATTCTTCTCACATCAACCCTTATATATAA
\
Edits in Original Sequence 
(5')GGTGTTAGTTGTGTTTATTCACCATCTATGAGGGATCCTTATAAGACCTTGAGGATTCAACCTGATGCTTCTGAATCTGATGTCAG
AAAGGCTTTTAGAAAGCTTGCTCTTCAGTATCACCCAGATGTGTGCAGAGGAAGTAATTGTGACATCCAATTCAACCAAATCAATGACGC
ATACGATACTGTGATGAGTAACTTGAGAGGTGAAACGAAGAGTGCAGAGATATATGAGGAATATGATGATGATGAATCCATGAGAGGGGT
AAATGATCCAGATTGGGATATGTGGGAAGAGTGGATGGGATGGGAAGGGGCCGGCATTCGCGACTATTCTTCTCACATCAACCCTTATAT
ATAA\(3')TTTTCTTGATAAATATGGTGTCTGGACCTAGCTTGTGAGCGCGTCTTACCTTAAATCTTTAATCTGGATTATAATGTTCGG
TTAAATACCTAAAAACCCATCCATCTTCATCAACTTAAAGATGGTTCGAGGTTCCTGTACATACTCAAAGGAGGGAGTTGTATATTTTTG
TACATAGATGGATCATGGAAGTCTCTCCTCTGTATTTATCAATTATAATGATGCAATTCTATCAATAAGAAGTTACATTACTGGAAAGAA
AAAAAAAAAAAAAACTCGAGACTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan