ESTScan Details for Unigene SGN-U203267

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
QFKAQLYMRGRPFANKSKCAKANMGAKNYAVVMPDANVEATLNSLFAAGFGAAGQWCATINNVVFVGGSDSWEDKLVERAKVSKVNAGTE
PGADLGPVISKQIKEQISQANPTVIDSGAKPXFLMGDRLRFYEDHIATGHVSSRDPGALARKFQIEIETRQVCINTX
Predicted Coding Sequence 
XCTCAATTCAAGGCTCAACTGTATATGCGTGGCAGACCATTTGCAAACAAAAGTAAATGTGCTAAGGCCAATATGGGAGCCAAGAATTAT
GCAGTTGTCATGCCTGATGCAAATGTTGAAGCTACTTTGAATTCTCTATTTGCTGCTGGTTTTGGTGCAGCAGGGCAATGGTGTGCAACA
ATTAACAATGTGGTCTTTGTCGGAGGCTCAGATTCATGGGAAGATAAACTAGTAGAACGTGCAAAGGTCTCAAAAGTAAATGCAGGAACA
GAACCTGGGGCAGACCTCGGACCAGTAATCAGCAAACAGATCAAGGAACAGATATCCCAAGCTAACCCAACAGTCATTGACAGTGGAGCC
AAACCTAGXTTCTTGATGGGAGACAGATTGCGCTTTTATGAAGATCATATTGCTACGGGACATGTATCTTCACGGGATCCXGGGGCACTT
GCGAGGAAATTCCAGATTGAGATTGAAACAAGGCAGGTTTGCATAAACACTGXX\
Edits in Original Sequence 
(5')XCTCAATTCAAGGCTCAACTGTATATGCGTGGCAGACCATTTGCAAACAAAAGTAAATGTGCTAAGGCCAATATGGGAGCCAAGAA
TTATGCAGTTGTCATGCCTGATGCAAATGTTGAAGCTACTTTGAATTCTCTATTTGCTGCTGGTTTTGGTGCAGCAGGGCAATGGTGTGC
AACAATTAACAATGTGGTCTTTGTCGGAGGCTCAGATTCATGGGAAGATAAACTAGTAGAACGTGCAAAGGTaCTCAAAAGTAAATGCAG
GAACAGAACCTGGGGCAGACCTCGGACCAGTAATCAGCAAACAGATCAAGGAACAGATATCCCAAGCTAACCCAAgCAGTCATTGACAGT
GGAGCCAAACCTAGXTTCTTGATGGGAGACAGATTGCGCTTTTATGAAGATCATATTGCTACGGGACATGTATCTTCACGGGATCCXGGG
GCACTTGCGAGGAAATTCCAGATTGAGATTGAAACAAGGCAGGTTTGCATAAACACTGXX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan