ESTScan Details for Unigene SGN-U203385

Score 
289
Direction 
Forward
Predicted Peptide Sequence 
LDPVLKVTGKVTYNGHELHEFVPQRTAVYISQHDLHIGEMTVRETLEFSADVKELARDXEMLAELSRIEKAANIKPDPDIDIYMKAVASE
GQEANVVTDYVLNILGLDICADTMVGDELX
Predicted Coding Sequence 
XXGCTTGATCCTGTTTTAAAGGTTACTGGTAAGGTGACTTATAATGGACATGAACTACATGAATTTGTACCACAAAGAACAGCTGTGTAT
ATCAGCCAACATGACTTGCATATTGGAGAAATGACTGTAAGAGAAACTTTGGAATTTTCTGCTGATGTCAAGGAGTTGGCTCGAGATXTT
GAAATGTTGGCTGAACTGTCAAGAATAGAGAAAGCAGCTAATATCAAACCAGATCCTGATATCGACATCTACATGAAGGCTGTAGCGTCA
GAAGGACAGGAAGCTAATGTTGTTACAGATTATGTTCTTAATATATTGGGACTTGACATATGTGCTGATACTATGGTGGGAGATGAATTG
ATX\
Edits in Original Sequence 
(5')XXGCTTGATCCTGTTTTAAAGGTTACTGGTAAGGTGACTTATAATGGACATGAACTACATGAATTTGTACCACAAAGAACAGCTGT
GTATATCAGCCAACATGACTTGCATATTGGAGAAATGACTGTAAGAGAAACTTTGGAATTTTCTGCaTGATGTCAAGGAGTTGGCTCGAG
ATXTTGAAATGTTGGCTGAACTGTCAAGAATAGAGAAAGCAGCTAATATCAAACCAGATCCTGATATCGACATCTACATGAAGGCTGTAG
CGTCAGAAGGACAGGAAGCTAATGTTGTTACAGATTATGTTCTTAATATATTGGGACTTGACATATGTGCTGATACTATGGTGGGAGATG
AATTGATX\(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan