ESTScan Details for Unigene SGN-U203457

Score 
640
Direction 
Forward
Predicted Peptide Sequence 
HQGTGMGGMGATGGMGDTGGMGAMGGGTGTGMGMGTGGTHGTGTGMGMGTGHHEGQQQLRRSDSSSSSEDDGQGGRRKKGIKEKIMEKMP
GGHGQQEGTEYGQHGQTTTTTTYGTTEEAGEKKGMMDKIKDKIPGMH
Predicted Coding Sequence 
XCTCACCAAGGTACTGGTATGGGGGGCATGGGTGCCACTGGTGGTATGGGAGACACTGGTGGAATGGGGGCCATGGGTGGAGGTACTGGC
ACTGGAATGGGTATGGGCACTGGTGGAACTCACGGCACTGGTACGGGCATGGGTATGGGTACTGGTCACCATGAGGGACAACAGCAGCTT
CGTCGATCCGACAGCTCTAGCTCTTCGGAGGATGATGGACAAGGTGGGAGGAGAAAGAAGGGCATAAAGGAGAAGATAATGGAGAAGATG
CCAGGAGGACATGGCCAACAGGAAGGCACTGAATATGGTCAACATGGGCAAACAACTACTACTACTACTTATGGTACTACTGAAGAAGCT
GGAGAGAAGAAGGGAATGATGGACAAAATCAAGGACAAGATCCCTGGGATGCATTGA\
Edits in Original Sequence 
(5')XCTCACCAAGGTACTGGTATGGGGGGCATGGGTGCCACTGGTGGTATGGGAGACACTGGTGGAATGGGGGCCATGGGTGGAGGTAC
TGGCACTGGAATGGGTATGGGCACTGGTGGAACTCACGGCACTGGTACGGGCATGGGTATGGGTACTGGTCACCATGAGGGACAACAGCA
GCTTCGTCGATCCGACAGCTCTAGCTCTTCGGAGGATGATGGACAAGGTGGGAGGAGAAAGAAGGGCATAAAGGAGAAGATAATGGAGAA
GATGCCAGGAGGACATGGCCAACAGGAAGGCACTGAATATGGTCAACATGGGCAAACAACTACTACTACTACTTATGGTACTACTGAAGA
AGCTGGAGAGAAGAAGGGAATGATGGACAAAATCAAGGACAAGATCCCTGGGATGCATTGA\(3')ACAATATGTTGATCATCCTTTGTC
TTCATTTCCAGCTTATGAATAAGTGTCTAAAAATTAGTGCCTGATTTTATTTCATGCACTGATTAGTAGTAAGTGTGATGTGAGTTATTC
CCAATGTTGTGTGTTTAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan